Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

MMP17 Rabbit pAb (A3030)

Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - MMP17 Rabbit pAb (A3030)

Western blot analysis of various lysates using MMP17 Rabbit pAb (A3030) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunohistochemistry - MMP17 Rabbit pAb (A3030)

Immunohistochemistry analysis of MMP17 in paraffin-embedded Human colon using MMP17 Rabbit pAb (A3030) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - MMP17 Rabbit pAb (A3030)

Immunohistochemistry analysis of MMP17 in paraffin-embedded Mouse brain using MMP17 Rabbit pAb (A3030) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

You may also interested in:

Overview

Product name MMP17 Rabbit pAb
Catalog No. A3030
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a member of the peptidase M10 family and membrane-type subfamily of matrix metalloproteinases (MMPs). Proteins in this family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Members of this subfamily contain a transmembrane domain suggesting that these proteins are expressed at the cell surface rather than secreted. The encoded preproprotein is proteolytically processed to generate the mature protease. This protein is unique among the membrane-type matrix metalloproteinases in that it is anchored to the cell membrane via a glycosylphosphatidylinositol (GPI) anchor. Elevated expression of the encoded protein has been observed in osteoarthritis and multiple human cancers.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 265-565 of human MMP17 (NP_057239.4).
Sequence IMRPYYQGPVGDPLRYGLPYEDKVRVWQLYGVRESVSPTAQPEEPPLLPEPPDNRSSAPPRKDVPHRCSTHFDAVAQIRGEAFFFKGKYFWRLTRDRHLVSLQPAQMHRFWRGLPLHLDSVDAVYERTSDHKIVFFKGDRYWVFKDNNVEEGYPRPVSDFSLPPGGIDAAFSWAHNDRTYFFKDQLYWRYDDHTRHMDPGYPAQSPLWRGVPSTLDDAMRWSDGASYFFRGQEYWKVLDGELEVAPGYPQSTARDWLVCGDSQADGSVAAGVDAAEGPRAPPGQHDQSRSEDGYEVCSCTS
Gene ID 4326
Swiss prot Q9ULZ9
Synonyms MMP-17; MT4MMP; MTMMP4; MT4-MMP; MMP17
Calculated MW 67kDa
Observed MW 75kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples SW480, RAW264.7, Mouse testis, Rat testis
Cellular location Cell membrane, Extracellular side, GPI-anchor, Lipid-anchor, Secreted, extracellular matrix, extracellular space

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

MMP17 Rabbit pAb images

ABclonal:Western blot - MMP17 Rabbit pAb (A3030)}

Western blot - MMP17 Rabbit pAb (A3030)

Western blot analysis of various lysates using MMP17 Rabbit pAb (A3030) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
ABclonal:Immunohistochemistry - MMP17 Rabbit pAb (A3030)}

Immunohistochemistry - MMP17 Rabbit pAb (A3030)

Immunohistochemistry analysis of MMP17 in paraffin-embedded Human colon using MMP17 Rabbit pAb (A3030) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - MMP17 Rabbit pAb (A3030)}

Immunohistochemistry - MMP17 Rabbit pAb (A3030)

Immunohistochemistry analysis of MMP17 in paraffin-embedded Mouse brain using MMP17 Rabbit pAb (A3030) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Inquire About This Product

Submit your question about A3030 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on MMP17. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to MMP17. (Distance between topics and target gene indicate popularity.) MMP17

* Data provided by citexs.com, for reference only.

Publishing research using A3030? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order