Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

MMP14/MT1-MMP Rabbit mAb (A0067)

Publications (3) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - MMP14/MT1-MMP Rabbit mAb (A0067)

Western blot analysis of extracts of various cell lines, using MMP14/MMP14/MT1-MMP Rabbit mAb (A0067) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Western blot - MMP14/MT1-MMP Rabbit mAb (A0067)

Western blot analysis of extracts of various cell lines, using MMP14/MMP14/MT1-MMP Rabbit mAb (A0067) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Flow CytoMetry - MMP14/MT1-MMP Rabbit mAb (A0067)

Flow cytometry: 1X10^6 MCF7 cells (negative control, left) and HT-1080 (right) cells were intracellularly-stained with MMP14/MT1-MMP Rabbit mAb (A0067, 2 μg/mL, orange line) or ABflo® 488 Rabbit IgG isotype control (AC042, 2 μg/mL, blue line), followed by Alexa Fluor® 488 conjugated goat anti-rabbit pAb staining. Non-fluorescently stained cells were used as blank control (red line).

ABclonal:Flow CytoMetry - MMP14/MT1-MMP Rabbit mAb (A0067)

Flow cytometry: 1X10^6 MCF7 cells (negative control, left) and HT-1080 (right) cells were intracellularly-stained with MMP14/MT1-MMP Rabbit mAb (A0067, 2 μg/mL, orange line) or ABflo® 488 Rabbit IgG isotype control (AC042, 2 μg/mL, blue line), followed by Alexa Fluor® 488 conjugated goat anti-rabbit pAb staining. Non-fluorescently stained cells were used as blank control (red line).

ABclonal:Flow CytoMetry - MMP14/MT1-MMP Rabbit mAb (A0067)

Flow cytometry: 1X10^6 MCF7 cells (negative control, left) and HT-1080 (right) cells were intracellularly-stained with MMP14/MT1-MMP Rabbit mAb (A0067, 2 μg/mL, orange line) or ABflo® 647 Rabbit IgG isotype control (AC042, 2 μg/mL, blue line), followed by Alexa Fluor® 647 conjugated goat anti-rabbit pAb staining. Non-fluorescently stained cells were used as blank control (red line).

ABclonal:Flow CytoMetry - MMP14/MT1-MMP Rabbit mAb (A0067)

Flow cytometry: 1X10^6 MCF7 cells (negative control, left) and HT-1080 (right) cells were intracellularly-stained with MMP14/MT1-MMP Rabbit mAb (A0067, 2 μg/mL, orange line) or ABflo® 647 Rabbit IgG isotype control (AC042, 2 μg/mL, blue line), followed by Alexa Fluor® 647 conjugated goat anti-rabbit pAb staining. Non-fluorescently stained cells were used as blank control (red line).

You may also interested in:

Overview

Product name MMP14/MT1-MMP Rabbit mAb
Catalog No. A0067
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC0211

Background

Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. However, the protein encoded by this gene is a member of the membrane-type MMP (MT-MMP) subfamily; each member of this subfamily contains a potential transmembrane domain suggesting that these proteins are expressed at the cell surface rather than secreted. This protein activates MMP2 protein, and this activity may be involved in tumor invasion.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human MMP14/MMP14/MT1-MMP (P50281).
Sequence GAEIKANVRRKRYAIQGLKWQHNEITFCIQNYTPKVGEYATYEAIRKAFRVWESATPLRFREVPYAYIREGHEKQADIMIFFAEGFHGDSTPFDGEGGFLA
Gene ID 4323
Swiss prot P50281
Synonyms MMP-14; MMP-X1; MT-MMP; MT1MMP; MTMMP1; WNCHRS; MT1-MMP; MT-MMP 1; MMP14/MT1-MMP
Calculated MW 66kDa
Observed MW 52kDa/60kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications Testing results
WB HumanMouseRat
Recommended dilution
  • WB 1:500 - 1:2000
  • FC 1:100 - 1:500
  • IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    Flow Cytometry    Immunohistochemistry    
Positive samples HeLa, HepG2, Mouse lung, Mouse kidney, Mouse heart, Rat heart
Cellular location Cytoplasm, Melanosome, Membrane, Single-pass type I membrane protein
Customer validation

WB (Oryctolagus cuniculus, Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

MMP14/MT1-MMP Rabbit mAb images

ABclonal:Western blot - MMP14/MT1-MMP Rabbit mAb (A0067)}

Western blot - MMP14/MT1-MMP Rabbit mAb (A0067)

Western blot analysis of extracts of various cell lines, using MMP14/MMP14/MT1-MMP Rabbit mAb (A0067) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
ABclonal:Western blot - MMP14/MT1-MMP Rabbit mAb (A0067)}

Western blot - MMP14/MT1-MMP Rabbit mAb (A0067)

Western blot analysis of extracts of various cell lines, using MMP14/MMP14/MT1-MMP Rabbit mAb (A0067) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
ABclonal:Flow CytoMetry - MMP14/MT1-MMP Rabbit mAb (A0067)}

Flow CytoMetry - MMP14/MT1-MMP Rabbit mAb (A0067)

Flow cytometry: 1X10^6 MCF7 cells (negative control, left) and HT-1080 (right) cells were intracellularly-stained with MMP14/MT1-MMP Rabbit mAb (A0067, 2 μg/mL, orange line) or ABflo® 488 Rabbit IgG isotype control (AC042, 2 μg/mL, blue line), followed by Alexa Fluor® 488 conjugated goat anti-rabbit pAb staining. Non-fluorescently stained cells were used as blank control (red line).
ABclonal:Flow CytoMetry - MMP14/MT1-MMP Rabbit mAb (A0067)}

Flow CytoMetry - MMP14/MT1-MMP Rabbit mAb (A0067)

Flow cytometry: 1X10^6 MCF7 cells (negative control, left) and HT-1080 (right) cells were intracellularly-stained with MMP14/MT1-MMP Rabbit mAb (A0067, 2 μg/mL, orange line) or ABflo® 488 Rabbit IgG isotype control (AC042, 2 μg/mL, blue line), followed by Alexa Fluor® 488 conjugated goat anti-rabbit pAb staining. Non-fluorescently stained cells were used as blank control (red line).
ABclonal:Flow CytoMetry - MMP14/MT1-MMP Rabbit mAb (A0067)}

Flow CytoMetry - MMP14/MT1-MMP Rabbit mAb (A0067)

Flow cytometry: 1X10^6 MCF7 cells (negative control, left) and HT-1080 (right) cells were intracellularly-stained with MMP14/MT1-MMP Rabbit mAb (A0067, 2 μg/mL, orange line) or ABflo® 647 Rabbit IgG isotype control (AC042, 2 μg/mL, blue line), followed by Alexa Fluor® 647 conjugated goat anti-rabbit pAb staining. Non-fluorescently stained cells were used as blank control (red line).
ABclonal:Flow CytoMetry - MMP14/MT1-MMP Rabbit mAb (A0067)}

Flow CytoMetry - MMP14/MT1-MMP Rabbit mAb (A0067)

Flow cytometry: 1X10^6 MCF7 cells (negative control, left) and HT-1080 (right) cells were intracellularly-stained with MMP14/MT1-MMP Rabbit mAb (A0067, 2 μg/mL, orange line) or ABflo® 647 Rabbit IgG isotype control (AC042, 2 μg/mL, blue line), followed by Alexa Fluor® 647 conjugated goat anti-rabbit pAb staining. Non-fluorescently stained cells were used as blank control (red line).

Inquire About This Product

Submit your question about A0067 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on MMP14. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to MMP14. (Distance between topics and target gene indicate popularity.) MMP14

* Data provided by citexs.com, for reference only.

Publishing research using A0067? Please let us know so that we can cite the reference in this datasheet.

Antibodies (2)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order