Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

MMP10 Rabbit pAb (A3033)

Publications (5) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - MMP10 Rabbit pAb (A3033)

Western blot analysis of various lysates using MMP10 Rabbit pAb (A3033) at 1:400 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.

ABclonal:Immunohistochemistry - MMP10 Rabbit pAb (A3033)

Immunohistochemistry analysis of MMP10 in paraffin-embedded rat kidney using MMP10 Rabbit pAb (A3033) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - MMP10 Rabbit pAb (A3033)

Immunohistochemistry analysis of MMP10 in paraffin-embedded mouse brain using MMP10 Rabbit pAb (A3033) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - MMP10 Rabbit pAb (A3033)

Immunofluorescence analysis of NIH-3T3 cells using MMP10 Rabbit pAb (A3033) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name MMP10 Rabbit pAb
Catalog No. A3033
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a member of the peptidase M10 family of matrix metalloproteinases (MMPs). Proteins in this family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. The encoded preproprotein is proteolytically processed to generate the mature protease. This secreted protease breaks down fibronectin, laminin, elastin, proteoglycan core protein, gelatins, and several types of collagen. The gene is part of a cluster of MMP genes on chromosome 11.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 237-476 of human MMP10 (NP_002416.1).
Sequence PLYNSFTELAQFRLSQDDVNGIQSLYGPPPASTEEPLVPTKSVPSGSEMPAKCDPALSFDAISTLRGEYLFFKDRYFWRRSHWNPEPEFHLISAFWPSLPSYLDAAYEVNSRDTVFIFKGNEFWAIRGNEVQAGYPRGIHTLGFPPTIRKIDAAVSDKEKKKTYFFAADKYWRFDENSQSMEQGFPRLIADDFPGVEPKVDAVLQAFGFFYFFSGSSQFEFDPNARMVTHILKSNSWLHC
Gene ID 4319
Swiss prot P09238
Synonyms SL-2; STMY2; MMP10
Calculated MW 54kDa
Observed MW 54kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples BT-474, MCF7, U-251MG, M21
Cellular location Secreted, extracellular matrix, extracellular space
Customer validation

IHC (Homo sapiens, Mus musculus)

WB (Homo sapiens, Mus musculus, Rattus norvegicus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

MMP10 Rabbit pAb images

ABclonal:Western blot - MMP10 Rabbit pAb (A3033)}

Western blot - MMP10 Rabbit pAb (A3033)

Western blot analysis of various lysates using MMP10 Rabbit pAb (A3033) at 1:400 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
ABclonal:Immunohistochemistry - MMP10 Rabbit pAb (A3033)}

Immunohistochemistry - MMP10 Rabbit pAb (A3033)

Immunohistochemistry analysis of MMP10 in paraffin-embedded rat kidney using MMP10 Rabbit pAb (A3033) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - MMP10 Rabbit pAb (A3033)}

Immunohistochemistry - MMP10 Rabbit pAb (A3033)

Immunohistochemistry analysis of MMP10 in paraffin-embedded mouse brain using MMP10 Rabbit pAb (A3033) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - MMP10 Rabbit pAb (A3033)}

Immunofluorescence - MMP10 Rabbit pAb (A3033)

Immunofluorescence analysis of NIH-3T3 cells using MMP10 Rabbit pAb (A3033) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A3033 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on MMP10. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to MMP10. (Distance between topics and target gene indicate popularity.) MMP10

* Data provided by citexs.com, for reference only.

Publishing research using A3033? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order