Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

MCCC2 Rabbit pAb (A15181)

Tested applications:WB IHC IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIPReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using MCCC2 Rabbit pAb (A15181) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunofluorescence - MCCC2 Rabbit pAb (A15181)

Immunofluorescence analysis of U2OS cells using MCCC2 antibody (A15181) at dilution of 1:100. Blue: DAPI for nuclear staining.

Overview

Product name	MCCC2 Rabbit pAb
Catalog No.	A15181
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes the small subunit of 3-methylcrotonyl-CoA carboxylase. This enzyme functions as a heterodimer and catalyzes the carboxylation of 3-methylcrotonyl-CoA to form 3-methylglutaconyl-CoA. Mutations in this gene are associated with 3-Methylcrotonylglycinuria, an autosomal recessive disorder of leucine catabolism.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 284-563 of human MCCC2 (NP_071415.1).
Sequence	LHLTRKVVRNLNYQKKLDVTIEPSEEPLFPADELYGIVGANLKRSFDVREVIARIVDGSRFTEFKAFYGDTLVTGFARIFGYPVGIVGNNGVLFSESAKKGTHFVQLCCQRNIPLLFLQNITGFMVGREYEAEGIAKDGAKMVAAVACAQVPKITLIIGGSYGAGNYGMCGRAYSPRFLYIWPNARISVMGGEQAANVLATITKDQRAREGKQFSSADEAALKEPIIKKFEEEGNPYYSSARVWDDGIIDPADTRLVLGLSFSAALNAPIEKTDFGIFRM
Gene ID	64087
Swiss prot	Q9HCC0
Synonyms	MCCC2; MCCB
Calculated MW	57kDa/61kDa
Observed MW	61kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP
Recommended dilution	WB 1:500 - 1:2000 IHC 1:50 - 1:100 IF/ICC 1:50 - 1:100
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. May contain BSA. If BSA-free batch required, please contact us.
Application key	Western blotting Immunohistochemistry
Positive samples	22Rv1, HeLa, HepG2, U-251MG, Mouse liver, Mouse kidney
Cellular location	Mitochondrion matrix

Research Area

MCCC2 Rabbit pAb images

Western blot - MCCC2 Rabbit pAb (A15181)

Immunofluorescence - MCCC2 Rabbit pAb (A15181)

Immunofluorescence analysis of U2OS cells using MCCC2 antibody (A15181) at dilution of 1:100. Blue: DAPI for nuclear staining.

Product Protocols

Inquire About This Product

Submit your question about A15181 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on MCCC2. (Numbers indicate number of published articles where both targets appear.)

◀1/▶

Related Research Area

Based on existing publications, the following research topics are related to MCCC2. (Distance between topics and target gene indicate popularity.) MCCC2

* Data provided by citexs.com, for reference only.