Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

MARK2 Rabbit mAb (A6512)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - MARK2 Rabbit mAb (A6512)

Western blot analysis of extracts of various cell lines, using MARK2 Rabbit mAb (A6512) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.

You may also interested in:

Overview

Product name MARK2 Rabbit mAb
Catalog No. A6512
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC1862

Background

This gene encodes a member of the Par-1 family of serine/threonine protein kinases. The protein is an important regulator of cell polarity in epithelial and neuronal cells, and also controls the stability of microtubules through phosphorylation and inactivation of several microtubule-associating proteins. The protein localizes to cell membranes. Multiple transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 689-788 of human MARK2 (Q7KZI7).
Sequence KPRSLRFTWSMKTTSSMEPNEMMREIRKVLDANSCQSELHEKYMLLCMHGTPGHEDFVQWEMEVCKLPRLSLNGVRFKRISGTSMAFKNIASKIANELKL
Gene ID 2011
Swiss prot Q7KZI7
Synonyms EMK1; EMK-1; PAR-1; Par1b; Par-1b; MARK2
Calculated MW 88kDa
Observed MW 88kDa/92kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications Testing results
WB HumanMouseRat
Recommended dilution
  • WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples BT-474, Raji, Mouse brain, Rat brain
Cellular location Cell membrane, Cytoplasm, Lateral cell membrane, Peripheral membrane protein, cytoskeleton

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

MARK2 Rabbit mAb images

ABclonal:Western blot - MARK2 Rabbit mAb (A6512)}

Western blot - MARK2 Rabbit mAb (A6512)

Western blot analysis of extracts of various cell lines, using MARK2 Rabbit mAb (A6512) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.

Inquire About This Product

Submit your question about A6512 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on MARK2. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to MARK2. (Distance between topics and target gene indicate popularity.) MARK2

* Data provided by citexs.com, for reference only.

Publishing research using A6512? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order