Products > Catalog Antibodies > Monoclonal Antibodies

MAP1LC3A Rabbit mAb (A12319)

Tested applications:WB IHC ICC IF IP ChIP ChIP-seq RIP FC ELISA MeDIP Nucleotide Array DB FACS CoIPReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using MAP1LC3A Rabbit mAb (A12319) at 1：1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

Western blot analysis of extracts of HeLa cells, using MAP1LC3A Rabbit mAb (A12319) at 1：1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunohistochemistry - MAP1LC3A Rabbit mAb (A12319)

Immunohistochemistry of paraffin-embedded human esophageal using MAP1LC3A Rabbit mAb (A12319) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunoprecipitation - MAP1LC3A Rabbit mAb (A12319)

Immunoprecipitation analysis of 300ug extracts of NIH/3T3 cells using 3ug MAP1LC3A antibody (A12319). Western blot was performed from the immunoprecipitate using MAP1LC3A antibody (A12319) at a dilition of 1:1000.NIH/3T3 cells were treated by Chloroquine (50 μM) at 37℃ for 20 hours.

Overview

Product name	MAP1LC3A Rabbit mAb
Catalog No.	A12319
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

MAP1A and MAP1B are microtubule-associated proteins which mediate the physical interactions between microtubules and components of the cytoskeleton. MAP1A and MAP1B each consist of a heavy chain subunit and multiple light chain subunits. The protein encoded by this gene is one of the light chain subunits and can associate with either MAP1A or MAP1B. Two transcript variants encoding different isoforms have been found for this gene. The expression of variant 1 is suppressed in many tumor cell lines, suggesting that may be involved in carcinogenesis. [provided by RefSeq, Feb 2012]

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MAP1LC3A (Q9H492).
Sequence	MPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYE
Gene ID	84557
Swiss prot	Q9H492
Synonyms	ATG8E; LC3; LC3A; MAP1ALC3; MAP1BLC3
Calculated MW	16kDa
Observed MW	16KDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC ICC IF IP ChIP ChIP-seq RIP FC ELISA MeDIP Nucleotide Array DB FACS CoIP
Recommended dilution	WB 1:500 - 1:2000 IHC 1:50 - 1:200 IP 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key	Western blotting Immunohistochemistry Immunoprecipitation
Positive samples	HeLa, Mouse brain, Rat brain, NIH/3T3, C6
Cellular location	Cytoplasm, Cytoplasmic vesicle, Endomembrane system, Lipid-anchor, autophagosome, autophagosome membrane, cytoskeleton
Customer validation	WB(Homo sapiens,Mus musculus, Sus scrofa, Rattus norvegicus) IF(Sus scrofa) IHC(Rattus norvegicus)