Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

MAP1LC3A Rabbit mAb (A12319)

Publications (5) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - MAP1LC3A Rabbit mAb (A12319)

Western blot analysis of lysates from NIH/3T3, C6 cells using MAP1LC3A Rabbit mAb (A12319) at 1:1000 dilution. NIH/3T3 cells and C6 cells were treated by Chloroquine (50 μM) at 37℃ for 20 hours.
Secondary antibody:HRP Goat Anti-Rabbit IgG (H+L)(AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection:ECL Basic Kit (RM00020).
Exposuretime: 180s.

ABclonal:Western blot - MAP1LC3A Rabbit mAb (A12319)

Western blot analysis of lysates from SH-SY5Y cells using MAP1LC3A Rabbit mAb(A12319) at 1:1000 dilution.
Secondary antibody:HRP Goat Anti-Rabbit IgG (H+L)(AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection:ECL Basic Kit (RM00020).
Exposuretime:10s.

ABclonal:Immunoprecipitation - MAP1LC3A Rabbit mAb (A12319)

Immunoprecipitation analysis of 300 μg extracts of NIH/3T3 cells using 3 μg MAP1LC3A antibody (A12319). Western blot was performed from the immunoprecipitate using MAP1LC3A antibody (A12319) at a dilution of 1:1000.NIH/3T3 cells were treated by Chloroquine (50 μM) at 37℃ for 20 hours.

You may also interested in:

Overview

Product name MAP1LC3A Rabbit mAb
Catalog No. A12319
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC2636

Background

MAP1A and MAP1B are microtubule-associated proteins which mediate the physical interactions between microtubules and components of the cytoskeleton. MAP1A and MAP1B each consist of a heavy chain subunit and multiple light chain subunits. The protein encoded by this gene is one of the light chain subunits and can associate with either MAP1A or MAP1B. Two transcript variants encoding different isoforms have been found for this gene. The expression of variant 1 is suppressed in many tumor cell lines, suggesting that may be involved in carcinogenesis.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MAP1LC3A (Q9H492).
Sequence MPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYE
Gene ID 84557
Swiss prot Q9H492
Synonyms LC3; LC3A; ATG8E; MAP1ALC3; MAP1BLC3; MAP1LC3A
Calculated MW 14kDa
Observed MW 14kDa, 16kDa/16kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications Testing results
WB Human
Recommended dilution
  • WB 1:500 - 1:1000
  • IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    Immunoprecipitation    
Positive samples NIH/3T3, C6, SH-SY5Y
Cellular location Cytoplasm, Cytoplasmic vesicle, Endomembrane system, Lipid-anchor, autophagosome, autophagosome membrane, cytoskeleton
Customer validation

WB (Homo sapiens, Sus scrofa, Mus musculus, Rattus norvegicus)

IHC (Rattus norvegicus)

IF (Sus scrofa)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

MAP1LC3A Rabbit mAb images

ABclonal:Western blot - MAP1LC3A Rabbit mAb (A12319)}

Western blot - MAP1LC3A Rabbit mAb (A12319)

Western blot analysis of lysates from NIH/3T3, C6 cells using MAP1LC3A Rabbit mAb (A12319) at 1:1000 dilution. NIH/3T3 cells and C6 cells were treated by Chloroquine (50 μM) at 37℃ for 20 hours.
Secondary antibody:HRP Goat Anti-Rabbit IgG (H+L)(AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection:ECL Basic Kit (RM00020).
Exposuretime: 180s.
ABclonal:Western blot - MAP1LC3A Rabbit mAb (A12319)}

Western blot - MAP1LC3A Rabbit mAb (A12319)

Western blot analysis of lysates from SH-SY5Y cells using MAP1LC3A Rabbit mAb(A12319) at 1:1000 dilution.
Secondary antibody:HRP Goat Anti-Rabbit IgG (H+L)(AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection:ECL Basic Kit (RM00020).
Exposuretime:10s.
ABclonal:Immunoprecipitation - MAP1LC3A Rabbit mAb (A12319)}

Immunoprecipitation - MAP1LC3A Rabbit mAb (A12319)

Immunoprecipitation analysis of 300 μg extracts of NIH/3T3 cells using 3 μg MAP1LC3A antibody (A12319). Western blot was performed from the immunoprecipitate using MAP1LC3A antibody (A12319) at a dilution of 1:1000.NIH/3T3 cells were treated by Chloroquine (50 μM) at 37℃ for 20 hours.

Inquire About This Product

Submit your question about A12319 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on MAP1LC3A. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to MAP1LC3A. (Distance between topics and target gene indicate popularity.) MAP1LC3A

* Data provided by citexs.com, for reference only.

Publishing research using A12319? Please let us know so that we can cite the reference in this datasheet.

Antibodies (2)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order