Product name | MAP1LC3A Rabbit pAb |
---|---|
Catalog No. | A11438 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MAP1LC3A (NP_115903.1). |
---|---|
Sequence | MPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYE |
Gene ID | 84557 |
Swiss prot | Q9H492 |
Synonyms | MAP1LC3A; ATG8E; LC3; LC3A; MAP1ALC3; MAP1BLC3 |
Calculated MW | 14kDa |
Observed MW | 18kDa |
Reactivity | Mouse, Rat |
---|---|
Tested applications | WBIHCICCIFIPChIPChIPseqRIPFCELISAMeDIPNucleotide ArrayDB |
Recommended dilution | WB 1:500 - 1:2000 IHC 1:50 - 1:200 |
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Application key | Western blotting Immunohistochemistry |
Positive samples | Mouse brain, Rat heart, Rat brain |
Cellular location | Cytoplasm, Cytoplasmic vesicle, Endomembrane system, Lipid-anchor, autophagosome, autophagosome membrane, cytoskeleton |
Customer validation | WB(Rattus norvegicus, Mus musculus) |
Submit your question about A11438 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Publishing research using A11438? Please let us know so that we can cite the reference in this datasheet.