Publications (2) Datasheet SDS COA
Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Reactivity:Human, Mouse
Product name | Lipoprotein lipase (LPL) Rabbit mAb |
---|---|
Catalog No. | A4115 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0904 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 376-475 of human Lipoprotein lipase (LPL) (P06858). |
---|---|
Sequence | IPFTLPEVSTNKTYSFLIYTEVDIGELLMLKLKWKSDSYFSWSDWWSSPGFAIQKIRVKAGETQKKVIFCSREKVSHLQKGKAPAVFVKCHDKSLNKKSG |
Gene ID | 4023 |
Swiss prot | P06858 |
Synonyms | LIPD; HDLCQ11; Lipoprotein lipase (LPL) |
Calculated MW | 53kDa |
Observed MW | 53kDa |
Reactivity | Human, Mouse |
---|---|
Tested applications | Testing results |
WB | |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Application key | Western blotting |
Positive samples | Human plasma, Mouse liver |
Cellular location | Cell membrane, GPI-anchor, Lipid-anchor, Secreted |
Customer validation | WB (Mus musculus, Scylla) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
Submit your question about A4115 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Based on existing publications, the following genes are closely related to research on LPL. (Numbers indicate number of published articles where both targets appear.)
Based on existing publications, the following research topics are related to LPL. (Distance between topics and target gene indicate popularity.) LPL
* Data provided by citexs.com, for reference only.
Publishing research using A4115? Please let us know so that we can cite the reference in this datasheet.
* For research use only. Not for therapeutic or diagnostic purposes.