Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

Lipoprotein lipase (LPL) Rabbit mAb (A4115)

Publications (2) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - Lipoprotein lipase (LPL) Rabbit mAb (A4115)

Western blot analysis of lysates from Human plasma, using Lipoprotein lipase (LPL) (LPL) Rabbit mAb (A4115) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.

ABclonal:Western blot - Lipoprotein lipase (LPL) Rabbit mAb (A4115)

Western blot analysis of lysates from Mouse liver, using Lipoprotein lipase (LPL) (LPL) Rabbit mAb (A4115) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.

You may also interested in:

Overview

Product name Lipoprotein lipase (LPL) Rabbit mAb
Catalog No. A4115
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC0904

Background

LPL encodes lipoprotein lipase, which is expressed in heart, muscle, and adipose tissue. LPL functions as a homodimer, and has the dual functions of triglyceride hydrolase and ligand/bridging factor for receptor-mediated lipoprotein uptake. Severe mutations that cause LPL deficiency result in type I hyperlipoproteinemia, while less extreme mutations in LPL are linked to many disorders of lipoprotein metabolism.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 376-475 of human Lipoprotein lipase (LPL) (P06858).
Sequence IPFTLPEVSTNKTYSFLIYTEVDIGELLMLKLKWKSDSYFSWSDWWSSPGFAIQKIRVKAGETQKKVIFCSREKVSHLQKGKAPAVFVKCHDKSLNKKSG
Gene ID 4023
Swiss prot P06858
Synonyms LIPD; HDLCQ11; Lipoprotein lipase (LPL)
Calculated MW 53kDa
Observed MW 53kDa

Applications

Reactivity Human, Mouse
Tested applications Testing results
WB Mouse
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples Human plasma, Mouse liver
Cellular location Cell membrane, GPI-anchor, Lipid-anchor, Secreted
Customer validation

WB (Mus musculus, Scylla)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Lipoprotein lipase (LPL) Rabbit mAb images

ABclonal:Western blot - Lipoprotein lipase (LPL) Rabbit mAb (A4115)}

Western blot - Lipoprotein lipase (LPL) Rabbit mAb (A4115)

Western blot analysis of lysates from Human plasma, using Lipoprotein lipase (LPL) (LPL) Rabbit mAb (A4115) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.
ABclonal:Western blot - Lipoprotein lipase (LPL) Rabbit mAb (A4115)}

Western blot - Lipoprotein lipase (LPL) Rabbit mAb (A4115)

Western blot analysis of lysates from Mouse liver, using Lipoprotein lipase (LPL) (LPL) Rabbit mAb (A4115) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.

Inquire About This Product

Submit your question about A4115 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on LPL. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to LPL. (Distance between topics and target gene indicate popularity.) LPL

* Data provided by citexs.com, for reference only.

Publishing research using A4115? Please let us know so that we can cite the reference in this datasheet.

Antibodies (1)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order