Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

Lamin B1 Rabbit mAb (A11495)

Publications (9) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - Lamin B1 Rabbit mAb (A11495)

Western blot analysis of various lysates using Lamin B1 Rabbit mAb (A11495) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunohistochemistry - Lamin B1 Rabbit mAb (A11495)

Immunohistochemistry analysis of Lamin B1 in paraffin-embedded human brain using Lamin B1 Rabbit mAb (A11495) at dilution of 1:400 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - Lamin B1 Rabbit mAb (A11495)

Immunohistochemistry analysis of Lamin B1 in paraffin-embedded human colon carcinoma using Lamin B1 Rabbit mAb (A11495) at dilution of 1:400 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - Lamin B1 Rabbit mAb (A11495)

Immunohistochemistry analysis of Lamin B1 in paraffin-embedded human colon using Lamin B1 Rabbit mAb (A11495) at dilution of 1:400 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - Lamin B1 Rabbit mAb (A11495)

Immunohistochemistry analysis of Lamin B1 in paraffin-embedded mouse colon using Lamin B1 Rabbit mAb (A11495) at dilution of 1:400 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - Lamin B1 Rabbit mAb (A11495)

Immunohistochemistry analysis of Lamin B1 in paraffin-embedded mouse kidney using Lamin B1 Rabbit mAb (A11495) at dilution of 1:400 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - Lamin B1 Rabbit mAb (A11495)

Immunohistochemistry analysis of Lamin B1 in paraffin-embedded rat kidney using Lamin B1 Rabbit mAb (A11495) at dilution of 1:400 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - Lamin B1 Rabbit mAb (A11495)

Immunohistochemistry analysis of Lamin B1 in paraffin-embedded human liver cancer using Lamin B1 Rabbit mAb (A11495) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - Lamin B1 Rabbit mAb (A11495)

Immunohistochemistry analysis of Lamin B1 in paraffin-embedded mouse liver using Lamin B1 Rabbit mAb (A11495) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - Lamin B1 Rabbit mAb (A11495)

Immunohistochemistry analysis of Lamin B1 in paraffin-embedded mouse testis using Lamin B1 Rabbit mAb (A11495) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - Lamin B1 Rabbit mAb (A11495)

Immunohistochemistry analysis of Lamin B1 in paraffin-embedded rat liver using Lamin B1 Rabbit mAb (A11495) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

You may also interested in:

Overview

Product name Lamin B1 Rabbit mAb
Catalog No. A11495
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC0621

Background

This gene encodes one of the two B-type lamin proteins and is a component of the nuclear lamina. A duplication of this gene is associated with autosomal dominant adult-onset leukodystrophy (ADLD). Alternative splicing results in multiple transcript variants.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 450-550 of human Lamin B1 (P20700).
Sequence DGKFIRLKNTSEQDQPMGGWEMIRKIGDTSVSYKYTSRYVLKAGQTVTIWAANAGVTASPPTDLIWKNQNSWGTGEDVKVILKNSQGEEVAQRSTVFKTTI
Gene ID 4001
Swiss prot P20700
Synonyms LMN; ADLD; LMN2; LMNB; MCPH26; Lamin B1
Calculated MW 66kDa
Observed MW 45kDa/70kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications Testing results
IHC-P HumanRat
WB HumanMouseRat
Recommended dilution
  • WB 1:500 - 1:2000
  • IHC-P 1:100 - 1:500
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples HeLa, HeLa+Staurosporine, Jurkat, U-87MG, Mouse liver, Mouse brain, Mouse spleen, Rat liver, Rat testis
Cellular location Lipid-anchor, Nucleoplasmic side, Nucleus inner membrane
Customer validation

WB (Rattus norvegicus, Homo sapiens, Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Lamin B1 Rabbit mAb images

ABclonal:Western blot - Lamin B1 Rabbit mAb (A11495)}

Western blot - Lamin B1 Rabbit mAb (A11495)

Western blot analysis of various lysates using Lamin B1 Rabbit mAb (A11495) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
ABclonal:Immunohistochemistry - Lamin B1 Rabbit mAb (A11495)}

Immunohistochemistry - Lamin B1 Rabbit mAb (A11495)

Immunohistochemistry analysis of Lamin B1 in paraffin-embedded human brain using Lamin B1 Rabbit mAb (A11495) at dilution of 1:400 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - Lamin B1 Rabbit mAb (A11495)}

Immunohistochemistry - Lamin B1 Rabbit mAb (A11495)

Immunohistochemistry analysis of Lamin B1 in paraffin-embedded human colon carcinoma using Lamin B1 Rabbit mAb (A11495) at dilution of 1:400 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - Lamin B1 Rabbit mAb (A11495)}

Immunohistochemistry - Lamin B1 Rabbit mAb (A11495)

Immunohistochemistry analysis of Lamin B1 in paraffin-embedded human colon using Lamin B1 Rabbit mAb (A11495) at dilution of 1:400 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - Lamin B1 Rabbit mAb (A11495)}

Immunohistochemistry - Lamin B1 Rabbit mAb (A11495)

Immunohistochemistry analysis of Lamin B1 in paraffin-embedded mouse colon using Lamin B1 Rabbit mAb (A11495) at dilution of 1:400 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - Lamin B1 Rabbit mAb (A11495)}

Immunohistochemistry - Lamin B1 Rabbit mAb (A11495)

Immunohistochemistry analysis of Lamin B1 in paraffin-embedded mouse kidney using Lamin B1 Rabbit mAb (A11495) at dilution of 1:400 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - Lamin B1 Rabbit mAb (A11495)}

Immunohistochemistry - Lamin B1 Rabbit mAb (A11495)

Immunohistochemistry analysis of Lamin B1 in paraffin-embedded rat kidney using Lamin B1 Rabbit mAb (A11495) at dilution of 1:400 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - Lamin B1 Rabbit mAb (A11495)}

Immunohistochemistry - Lamin B1 Rabbit mAb (A11495)

Immunohistochemistry analysis of Lamin B1 in paraffin-embedded human liver cancer using Lamin B1 Rabbit mAb (A11495) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - Lamin B1 Rabbit mAb (A11495)}

Immunohistochemistry - Lamin B1 Rabbit mAb (A11495)

Immunohistochemistry analysis of Lamin B1 in paraffin-embedded mouse liver using Lamin B1 Rabbit mAb (A11495) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - Lamin B1 Rabbit mAb (A11495)}

Immunohistochemistry - Lamin B1 Rabbit mAb (A11495)

Immunohistochemistry analysis of Lamin B1 in paraffin-embedded mouse testis using Lamin B1 Rabbit mAb (A11495) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - Lamin B1 Rabbit mAb (A11495)}

Immunohistochemistry - Lamin B1 Rabbit mAb (A11495)

Immunohistochemistry analysis of Lamin B1 in paraffin-embedded rat liver using Lamin B1 Rabbit mAb (A11495) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Inquire About This Product

Submit your question about A11495 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on LMNB1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to LMNB1. (Distance between topics and target gene indicate popularity.) LMNB1

* Data provided by citexs.com, for reference only.

Publishing research using A11495? Please let us know so that we can cite the reference in this datasheet.

Antibodies (4)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order