Publications (9) Datasheet SDS COA
Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Reactivity:Human, Mouse, Rat
Product name | Lamin B1 Rabbit mAb |
---|---|
Catalog No. | A11495 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0621 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 450-550 of human Lamin B1 (P20700). |
---|---|
Sequence | DGKFIRLKNTSEQDQPMGGWEMIRKIGDTSVSYKYTSRYVLKAGQTVTIWAANAGVTASPPTDLIWKNQNSWGTGEDVKVILKNSQGEEVAQRSTVFKTTI |
Gene ID | 4001 |
Swiss prot | P20700 |
Synonyms | LMN; ADLD; LMN2; LMNB; MCPH26; Lamin B1 |
Calculated MW | 66kDa |
Observed MW | 45kDa/70kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | Testing results |
IHC-P | |
WB | |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Application key | Western blotting Immunohistochemistry |
Positive samples | HeLa, HeLa+Staurosporine, Jurkat, U-87MG, Mouse liver, Mouse brain, Mouse spleen, Rat liver, Rat testis |
Cellular location | Lipid-anchor, Nucleoplasmic side, Nucleus inner membrane |
Customer validation | WB (Rattus norvegicus, Homo sapiens, Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
Submit your question about A11495 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Based on existing publications, the following genes are closely related to research on LMNB1. (Numbers indicate number of published articles where both targets appear.)
Based on existing publications, the following research topics are related to LMNB1. (Distance between topics and target gene indicate popularity.) LMNB1
* Data provided by citexs.com, for reference only.
Publishing research using A11495? Please let us know so that we can cite the reference in this datasheet.
* For research use only. Not for therapeutic or diagnostic purposes.