Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

LOXL2 Rabbit mAb (A4708)

Publications (2) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human

ABclonal:Western blot - LOXL2 Rabbit mAb (A4708)

Western blot analysis of extracts of various cell lines, using LOXL2 Rabbit mAb (A4708) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

You may also interested in:

Overview

Product name LOXL2 Rabbit mAb
Catalog No. A4708
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC1100

Background

This gene encodes a member of the lysyl oxidase gene family. The prototypic member of the family is essential to the biogenesis of connective tissue, encoding an extracellular copper-dependent amine oxidase that catalyses the first step in the formation of crosslinks in collagens and elastin. A highly conserved amino acid sequence at the C-terminus end appears to be sufficient for amine oxidase activity, suggesting that each family member may retain this function. The N-terminus is poorly conserved and may impart additional roles in developmental regulation, senescence, tumor suppression, cell growth control, and chemotaxis to each member of the family.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 675-774 of human LOXL2 (Q9Y4K0).
Sequence NFGDQGITMGCWDMYRHDIDCQWVDITDVPPGDYLFQVVINPNFEVAESDYSNNIMKCRSRYDGHRIWMYNCHIGGSFSEETEKKFEHFSGLLNNQLSPQ
Gene ID 4017
Swiss prot Q9Y4K0
Synonyms LOR; LOR2; WS9-14; LOXL2
Calculated MW 87kDa
Observed MW 100kDa

Applications

Reactivity Human
Tested applications Testing results
WB Human
Recommended dilution
  • WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples A-549, PC-3
Cellular location Chromosome, Nucleus, Secreted, basement membrane, extracellular matrix, extracellular space
Customer validation

WB (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

LOXL2 Rabbit mAb images

ABclonal:Western blot - LOXL2 Rabbit mAb (A4708)}

Western blot - LOXL2 Rabbit mAb (A4708)

Western blot analysis of extracts of various cell lines, using LOXL2 Rabbit mAb (A4708) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Inquire About This Product

Submit your question about A4708 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on LOXL2. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to LOXL2. (Distance between topics and target gene indicate popularity.) LOXL2

* Data provided by citexs.com, for reference only.

Publishing research using A4708? Please let us know so that we can cite the reference in this datasheet.

Antibodies (1)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order