Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

Lamin B1 Rabbit pAb (A16685)

Publications (3) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - Lamin B1 Rabbit pAb (A16685)

Western blot analysis of various lysates using Lamin B1 Rabbit pAb (A16685) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunofluorescence - Lamin B1 Rabbit pAb (A16685)

Confocal immunofluorescence analysis of HeLa cells using Lamin B1 Rabbit pAb (A16685) at dilution of 1:100 (60x lens). Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - Lamin B1 Rabbit pAb (A16685)

Confocal immunofluorescence analysis of MCF-7 cells using Lamin B1 Rabbit pAb (A16685) at dilution of 1:100 (60x lens). Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name Lamin B1 Rabbit pAb
Catalog No. A16685
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes one of the two B-type lamin proteins and is a component of the nuclear lamina. A duplication of this gene is associated with autosomal dominant adult-onset leukodystrophy (ADLD). Alternative splicing results in multiple transcript variants.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 361-460 of human Lamin B1 (NP_005564.1).
Sequence EQLLDVKLALDMEISAYRKLLEGEEERLKLSPSPSSRVTVSRASSSRSVRTTRGKRKRVDVEESEASSSVSISHSASATGNVCIEEIDVDGKFIRLKNTS
Gene ID 4001
Swiss prot P20700
Synonyms LMN; ADLD; LMN2; LMNB; MCPH26; Lamin B1
Calculated MW 66kDa
Observed MW 70kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IF/ICC 1:50 - 1:200
  • IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    Immunoprecipitation    
Positive samples Jurkat, MCF7, mouse brain, mouse spleen
Cellular location Lipid-anchor, Nucleoplasmic side, Nucleus inner membrane
Customer validation

IP (Homo sapiens)

WB (Homo sapiens, Rattus norvegicus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Lamin B1 Rabbit pAb images

ABclonal:Western blot - Lamin B1 Rabbit pAb (A16685)}

Western blot - Lamin B1 Rabbit pAb (A16685)

Western blot analysis of various lysates using Lamin B1 Rabbit pAb (A16685) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
ABclonal:Immunofluorescence - Lamin B1 Rabbit pAb (A16685)}

Immunofluorescence - Lamin B1 Rabbit pAb (A16685)

Confocal immunofluorescence analysis of HeLa cells using Lamin B1 Rabbit pAb (A16685) at dilution of 1:100 (60x lens). Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - Lamin B1 Rabbit pAb (A16685)}

Immunofluorescence - Lamin B1 Rabbit pAb (A16685)

Confocal immunofluorescence analysis of MCF-7 cells using Lamin B1 Rabbit pAb (A16685) at dilution of 1:100 (60x lens). Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A16685 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on LMNB1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to LMNB1. (Distance between topics and target gene indicate popularity.) LMNB1

* Data provided by citexs.com, for reference only.

Publishing research using A16685? Please let us know so that we can cite the reference in this datasheet.

Antibodies (4)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order