Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

LMBRD2 Rabbit pAb (A20757)

Datasheet

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Mouse

ABclonal:Western blot - LMBRD2 Rabbit pAb (A20757)

Western blot analysis of lysates from Mouse brain, using LMBRD2 Rabbit pAb (A20757) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

You may also interested in:

Overview

Product name LMBRD2 Rabbit pAb
Catalog No. A20757
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Involved in adrenergic receptor signaling pathway. Located in membrane.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 210-390 of human LMBRD2 (NP_001007528.1).
Sequence PRSYWNGAKRGYLLMKTYFKAAKLMTEKADAEENLEDAMEEVRKVNESIKYNHPLRKCVDTILKKCPTEYQEKMGRNMDDYEDFDEKHSIYPSEKSLVKLHKQVIYSVQRHRRTQVQWQILLEQAFYLEDVAKNETSATHQFVHTFQSPEPENRFIQYFYNPTFEWYWECLLRPWFYKILA
Gene ID 92255
Swiss prot Q68DH5
Synonyms DENBA; LMBRD2
Calculated MW 81kDa
Observed MW 81kDa

Applications

Reactivity Mouse
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples Mouse brain
Cellular location plasma membrane

LMBRD2 Rabbit pAb images

ABclonal:Western blot - LMBRD2 Rabbit pAb (A20757)}

Western blot - LMBRD2 Rabbit pAb (A20757)

Western blot analysis of lysates from Mouse brain, using LMBRD2 Rabbit pAb (A20757) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Inquire About This Product

Submit your question about A20757 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on LMBRD2. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to LMBRD2. (Distance between topics and target gene indicate popularity.) LMBRD2

* Data provided by citexs.com, for reference only.

Publishing research using A20757? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order