Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

LIF Rabbit pAb (A1288)

Publications (3) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Immunohistochemistry - LIF Rabbit pAb (A1288)

Immunohistochemistry analysis of LIF in paraffin-embedded human liver tissue using LIF Rabbit pAb (A1288) at a dilution of  1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Western blot - LIF Rabbit pAb (A1288)

Western blot analysis of various lysates, using LIF Rabbit pAb (A1288) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

You may also interested in:

Overview

Product name LIF Rabbit pAb
Catalog No. A1288
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The protein encoded by this gene is a pleiotropic cytokine with roles in several different systems. It is involved in the induction of hematopoietic differentiation in normal and myeloid leukemia cells, induction of neuronal cell differentiation, regulator of mesenchymal to epithelial conversion during kidney development, and may also have a role in immune tolerance at the maternal-fetal interface. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 23-202 of human LIF (NP_002300.1).
Sequence SPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF
Gene ID 3976
Swiss prot P15018
Synonyms CDF; DIA; HILDA; MLPLI; LIF
Calculated MW 22kDa
Observed MW 35kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples A-549, U-138MG, HL-60(Negative control), Mouse lung, NIH/3T3
Cellular location Secreted
Customer validation

WB (Mus musculus, Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

LIF Rabbit pAb images

ABclonal:Immunohistochemistry - LIF Rabbit pAb (A1288)}

Immunohistochemistry - LIF Rabbit pAb (A1288)

Immunohistochemistry analysis of LIF in paraffin-embedded human liver tissue using LIF Rabbit pAb (A1288) at a dilution of  1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Western blot - LIF Rabbit pAb (A1288)}

Western blot - LIF Rabbit pAb (A1288)

Western blot analysis of various lysates, using LIF Rabbit pAb (A1288) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

Inquire About This Product

Submit your question about A1288 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on LIF. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to LIF. (Distance between topics and target gene indicate popularity.) LIF

* Data provided by citexs.com, for reference only.

Publishing research using A1288? Please let us know so that we can cite the reference in this datasheet.

Proteins (2)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order