Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

LEPRE1 Rabbit pAb (A10322)

Datasheet SDS

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human

ABclonal:Western blot - LEPRE1 Rabbit pAb (A10322)

Western blot analysis of extracts of various cell lines, using LEPRE1 antibody (A10322) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

You may also interested in:

Overview

Product name LEPRE1 Rabbit pAb
Catalog No. A10322
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes an enzyme that is a member of the collagen prolyl hydroxylase family. These enzymes are localized to the endoplasmic reticulum and their activity is required for proper collagen synthesis and assembly. Mutations in this gene are associated with osteogenesis imperfecta type VIII. Three alternatively spliced transcript variants encoding different isoforms have been described. Other variants may exist, but their biological validity has not been determined.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 497-736 of human LEPRE1 (NP_071751.3).
Sequence GDGYRGQTSPHTPNEKFYGVTVFKALKLGQEGKVPLQSAHLYYNVTEKVRRIMESYFRLDTPLYFSYSHLVCRTAIEEVQAERKDDSHPVHVDNCILNAETLVCVKEPPAYTFRDYSAILYLNGDFDGGNFYFTELDAKTVTAEVQPQCGRAVGFSSGTENPHGVKAVTRGQRCAIALWFTLDPRHSERDRVQADDLVKMLFSPEEMDLSQEQPLDAQQGPPEPAQESLSGSESKPKDEL
Gene ID 64175
Swiss prot Q32P28
Synonyms OI8; GROS1; LEPRE1
Calculated MW 83kDa
Observed MW 100kDa

Applications

Reactivity Human
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:1000 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples A375, NCI-H460, HT-29, HeLa, SKOV3
Cellular location Endoplasmic reticulum, Secreted, extracellular matrix, extracellular space

Research Area

LEPRE1 Rabbit pAb images

ABclonal:Western blot - LEPRE1 Rabbit pAb (A10322)}

Western blot - LEPRE1 Rabbit pAb (A10322)

Western blot analysis of extracts of various cell lines, using LEPRE1 antibody (A10322) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Inquire About This Product

Submit your question about A10322 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on P3H1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to P3H1. (Distance between topics and target gene indicate popularity.) P3H1

* Data provided by citexs.com, for reference only.

Publishing research using A10322? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order