Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

LDHA Rabbit pAb (A1146)

Reviews (3) Publications (22) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - LDHA Rabbit pAb (A1146)

Western blot analysis of lysates from Rat liver using LDHA Rabbit pAb(A1146) at 1:800 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

ABclonal:Western blot - LDHA Rabbit pAb (A1146)

Western blot analysis of lysates from wild type (WT) and LDHA knockdown (KD) 293T cells using LDHA Rabbit pAb (A1146) at 1:800 dilution.
Secondary antibody:HRP Goat Anti-Rabbit IgG (H+L)(AS014) at 1:10000 dilution.Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

ABclonal:Western blot - LDHA Rabbit pAb (A1146)

Western blot analysis of lysates from HeLa cells using LDHA Rabbit pAb(A1146) at 1:800 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

ABclonal:Immunohistochemistry - LDHA Rabbit pAb (A1146)

Immunohistochemistry analysis of LDHA in paraffin-embedded rat liver tissue using LDHA Rabbit pAb (A1146) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunohistochemistry - LDHA Rabbit pAb (A1146)

Immunohistochemistry analysis of LDHA in paraffin-embedded rat kidney tissue using LDHA Rabbit pAb (A1146) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunohistochemistry - LDHA Rabbit pAb (A1146)

Immunohistochemistry analysis of LDHA in paraffin-embedded mouse kidney tissue using LDHA Rabbit pAb (A1146) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunohistochemistry - LDHA Rabbit pAb (A1146)

Immunohistochemistry analysis of LDHA in paraffin-embedded rat large intestine tissue using LDHA Rabbit pAb (A1146) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunohistochemistry - LDHA Rabbit pAb (A1146)

Immunohistochemistry analysis of LDHA in paraffin-embedded human colon tissue using LDHA Rabbit pAb (A1146) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunohistochemistry - LDHA Rabbit pAb (A1146)

Immunohistochemistry analysis of LDHA in paraffin-embedded human liver tissue using LDHA Rabbit pAb (A1146) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunohistochemistry - LDHA Rabbit pAb (A1146)

Immunohistochemistry analysis of LDHA in paraffin-embedded mouse brain tissue using LDHA Rabbit pAb (A1146) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunofluorescence - LDHA Rabbit pAb (A1146)

Immunofluorescence analysis of HeLa cells using LDHA Rabbit pAb (A1146) at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - LDHA Rabbit pAb (A1146)

Immunofluorescence analysis of MCF7 cells using LDHA Rabbit pAb (A1146) at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Review
ABclonal: review for LDHA Rabbit pAb(A1146)
Review
ABclonal: review for LDHA Rabbit pAb(A1146)
Review
ABclonal: review for LDHA Rabbit pAb(A1146)

You may also interested in:

Overview

Product name LDHA Rabbit pAb
Catalog No. A1146
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The protein encoded by this gene catalyzes the conversion of L-lactate and NAD to pyruvate and NADH in the final step of anaerobic glycolysis. The protein is found predominantly in muscle tissue and belongs to the lactate dehydrogenase family. Mutations in this gene have been linked to exertional myoglobinuria. Multiple transcript variants encoding different isoforms have been found for this gene. The human genome contains several non-transcribed pseudogenes of this gene.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-332 of human LDHA (NP_005557.1).
Sequence MATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTLWGIQKELQF
Gene ID 3939
Swiss prot P00338
Synonyms LDHM; GSD11; PIG19; HEL-S-133P; LDHA
Calculated MW 37kDa
Observed MW 37kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
  • IP 0.5ug-4ug antibody for 200ug-400ug extracts of whole cells
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    Immunoprecipitation    
Positive samples 293T, Rat liver, HeLa
Cellular location Cytoplasm
Customer validation

IHC (Human lung cancer cellsMus musculus)

WB (Human lung cancer cells, unknowMus musculus, Homo sapiens, Sus scrofa, Mus musculus, Gallus gallus)

IP (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

LDHA Rabbit pAb images

ABclonal:Western blot - LDHA Rabbit pAb (A1146)}

Western blot - LDHA Rabbit pAb (A1146)

Western blot analysis of lysates from Rat liver using LDHA Rabbit pAb(A1146) at 1:800 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
ABclonal:Western blot - LDHA Rabbit pAb (A1146)}

Western blot - LDHA Rabbit pAb (A1146)

Western blot analysis of lysates from wild type (WT) and LDHA knockdown (KD) 293T cells using LDHA Rabbit pAb (A1146) at 1:800 dilution.
Secondary antibody:HRP Goat Anti-Rabbit IgG (H+L)(AS014) at 1:10000 dilution.Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
ABclonal:Western blot - LDHA Rabbit pAb (A1146)}

Western blot - LDHA Rabbit pAb (A1146)

Western blot analysis of lysates from HeLa cells using LDHA Rabbit pAb(A1146) at 1:800 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
ABclonal:Immunohistochemistry - LDHA Rabbit pAb (A1146)}

Immunohistochemistry - LDHA Rabbit pAb (A1146)

Immunohistochemistry analysis of LDHA in paraffin-embedded rat liver tissue using LDHA Rabbit pAb (A1146) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunohistochemistry - LDHA Rabbit pAb (A1146)}

Immunohistochemistry - LDHA Rabbit pAb (A1146)

Immunohistochemistry analysis of LDHA in paraffin-embedded rat kidney tissue using LDHA Rabbit pAb (A1146) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunohistochemistry - LDHA Rabbit pAb (A1146)}

Immunohistochemistry - LDHA Rabbit pAb (A1146)

Immunohistochemistry analysis of LDHA in paraffin-embedded mouse kidney tissue using LDHA Rabbit pAb (A1146) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunohistochemistry - LDHA Rabbit pAb (A1146)}

Immunohistochemistry - LDHA Rabbit pAb (A1146)

Immunohistochemistry analysis of LDHA in paraffin-embedded rat large intestine tissue using LDHA Rabbit pAb (A1146) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunohistochemistry - LDHA Rabbit pAb (A1146)}

Immunohistochemistry - LDHA Rabbit pAb (A1146)

Immunohistochemistry analysis of LDHA in paraffin-embedded human colon tissue using LDHA Rabbit pAb (A1146) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunohistochemistry - LDHA Rabbit pAb (A1146)}

Immunohistochemistry - LDHA Rabbit pAb (A1146)

Immunohistochemistry analysis of LDHA in paraffin-embedded human liver tissue using LDHA Rabbit pAb (A1146) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunohistochemistry - LDHA Rabbit pAb (A1146)}

Immunohistochemistry - LDHA Rabbit pAb (A1146)

Immunohistochemistry analysis of LDHA in paraffin-embedded mouse brain tissue using LDHA Rabbit pAb (A1146) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunofluorescence - LDHA Rabbit pAb (A1146)}

Immunofluorescence - LDHA Rabbit pAb (A1146)

Immunofluorescence analysis of HeLa cells using LDHA Rabbit pAb (A1146) at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - LDHA Rabbit pAb (A1146)}

Immunofluorescence - LDHA Rabbit pAb (A1146)

Immunofluorescence analysis of MCF7 cells using LDHA Rabbit pAb (A1146) at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Submit an review for A1146

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A1146 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on LDHA. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to LDHA. (Distance between topics and target gene indicate popularity.) LDHA

* Data provided by citexs.com, for reference only.

Publishing research using A1146? Please let us know so that we can cite the reference in this datasheet.

Antibodies (6)

Proteins (1)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order