Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

LC3A/LC3B Rabbit pAb (A5618)

Publications (30) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - LC3A/LC3B Rabbit pAb (A5618)

Western blot analysis of various lysates using LC3A/LC3B Rabbit pAb (A5618) at 1:500 dilution.293T cells were treated by Chloroquine (50 μM) at 37℃ for 20 hours.NIH/3T3 cells were treated by Chloroquine (50 μM) at 37℃ for 20 hours.C6 cells were treated by Chloroquine (50 μM) at 37℃ for 20 hours.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% BSA.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 3min.

ABclonal:Western blot - LC3A/LC3B Rabbit pAb (A5618)

Western blot analysis of various lysates, using LC3A/LC3B Rabbit pAb (A5618) at 1:2000 dilution.293T, NIH/3T3 and C6 cells were treated by Chloroquine (50 μM) at 37℃ for 20 hours.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunohistochemistry - LC3A/LC3B Rabbit pAb (A5618)

Immunohistochemistry analysis of LC3A/LC3B in paraffin-embedded human colon carcinoma using LC3A/LC3B Rabbit pAb (A5618) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - LC3A/LC3B Rabbit pAb (A5618)

Immunohistochemistry analysis of LC3A/LC3B in paraffin-embedded human lung cancer using LC3A/LC3B Rabbit pAb (A5618) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - LC3A/LC3B Rabbit pAb (A5618)

Immunohistochemistry analysis of LC3A/LC3B in paraffin-embedded mouse testis using LC3A/LC3B Rabbit pAb (A5618) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - LC3A/LC3B Rabbit pAb (A5618)

Immunohistochemistry analysis of LC3A/LC3B in paraffin-embedded rat brain using LC3A/LC3B Rabbit pAb (A5618) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - LC3A/LC3B Rabbit pAb (A5618)

Immunofluorescence analysis of 293T Treated with Chloroquine and 293T cells using LC3A/LC3B Rabbit pAb (A5618) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name LC3A/LC3B Rabbit pAb
Catalog No. A5618
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

MAP1A and MAP1B are microtubule-associated proteins which mediate the physical interactions between microtubules and components of the cytoskeleton. MAP1A and MAP1B each consist of a heavy chain subunit and multiple light chain subunits. The protein encoded by this gene is one of the light chain subunits and can associate with either MAP1A or MAP1B. Two transcript variants encoding different isoforms have been found for this gene. The expression of variant 1 is suppressed in many tumor cell lines, suggesting that may be involved in carcinogenesis.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-60 of human LC3A (NP_115903.1).
Sequence MPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNM
Gene ID 8455781631
Swiss prot Q9GZQ8Q9H492
Synonyms MAP1LC3B; ATG8F; LC3B; MAP1A/1BLC3; MAP1LC3B-a; MAP1LC3A; ATG8E; LC3; LC3A; MAP1ALC3; MAP1BLC3; LC3A/LC3B
Calculated MW 14kDa
Observed MW 14kDa/16kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples 293T+Chloroquine, C6+Chloroquine
Cellular location Cytoplasm, Cytoplasmic vesicle, Endomembrane system, Lipid-anchor, autophagosome, autophagosome membrane, cytoskeleton
Customer validation

WB (Gallus gallus, Rattus norvegicus, Homo sapiens, Mus musculus, Ctenopharyngodon idellus, Sus scrofa, Chlorocebus sabaeus, Pollen, Horabagrus nigricollaris)

IF (Gallus gallus, Pollen, Mus musculus, Rattus norvegicus, Other)

IHC (Sus scrofa)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

LC3A/LC3B Rabbit pAb images

ABclonal:Western blot - LC3A/LC3B Rabbit pAb (A5618)}

Western blot - LC3A/LC3B Rabbit pAb (A5618)

Western blot analysis of various lysates using LC3A/LC3B Rabbit pAb (A5618) at 1:500 dilution.293T cells were treated by Chloroquine (50 μM) at 37℃ for 20 hours.NIH/3T3 cells were treated by Chloroquine (50 μM) at 37℃ for 20 hours.C6 cells were treated by Chloroquine (50 μM) at 37℃ for 20 hours.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% BSA.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 3min.
ABclonal:Western blot - LC3A/LC3B Rabbit pAb (A5618)}

Western blot - LC3A/LC3B Rabbit pAb (A5618)

Western blot analysis of various lysates, using LC3A/LC3B Rabbit pAb (A5618) at 1:2000 dilution.293T, NIH/3T3 and C6 cells were treated by Chloroquine (50 μM) at 37℃ for 20 hours.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
ABclonal:Immunohistochemistry - LC3A/LC3B Rabbit pAb (A5618)}

Immunohistochemistry - LC3A/LC3B Rabbit pAb (A5618)

Immunohistochemistry analysis of LC3A/LC3B in paraffin-embedded human colon carcinoma using LC3A/LC3B Rabbit pAb (A5618) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - LC3A/LC3B Rabbit pAb (A5618)}

Immunohistochemistry - LC3A/LC3B Rabbit pAb (A5618)

Immunohistochemistry analysis of LC3A/LC3B in paraffin-embedded human lung cancer using LC3A/LC3B Rabbit pAb (A5618) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - LC3A/LC3B Rabbit pAb (A5618)}

Immunohistochemistry - LC3A/LC3B Rabbit pAb (A5618)

Immunohistochemistry analysis of LC3A/LC3B in paraffin-embedded mouse testis using LC3A/LC3B Rabbit pAb (A5618) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - LC3A/LC3B Rabbit pAb (A5618)}

Immunohistochemistry - LC3A/LC3B Rabbit pAb (A5618)

Immunohistochemistry analysis of LC3A/LC3B in paraffin-embedded rat brain using LC3A/LC3B Rabbit pAb (A5618) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - LC3A/LC3B Rabbit pAb (A5618)}

Immunofluorescence - LC3A/LC3B Rabbit pAb (A5618)

Immunofluorescence analysis of 293T Treated with Chloroquine and 293T cells using LC3A/LC3B Rabbit pAb (A5618) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A5618 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on MAP1LC3A. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to MAP1LC3A. (Distance between topics and target gene indicate popularity.) MAP1LC3A

* Data provided by citexs.com, for reference only.

Publishing research using A5618? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order