Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

LAMP1 Rabbit pAb (A2582)

Review (1) Publications (16) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human

ABclonal:Western blot - LAMP1 Rabbit pAb (A2582)

Western blot analysis of lysates from U-937 cells, using LAMP1 Rabbit pAb (A2582) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Western blot - LAMP1 Rabbit pAb (A2582)

Western blot analysis of lysates from wild type(WT) and LAMP1 knockout (KO) HeLa cells, using LAMP1 Rabbit pAb (A2582) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Review
ABclonal: review for LAMP1 Rabbit pAb(A2582)

You may also interested in:

Overview

Product name LAMP1 Rabbit pAb
Catalog No. A2582
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The protein encoded by this gene is a member of a family of membrane glycoproteins. This glycoprotein provides selectins with carbohydrate ligands. It may also play a role in tumor cell metastasis.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 150-250 of human LAMP1 (NP_005552.3).
Sequence DKKYRCVSGTQVHMNNVTVTLHDATIQAYLSNSSFSRGETRCEQDRPSPTTAPPAPPSPSPSPVPKSPSVDKYNVSGTNGTCLLASMGLQLNLTYERKDNT
Gene ID 3916
Swiss prot P11279
Synonyms LAMPA; CD107a; LGP120; LAMP1
Calculated MW 45kDa
Observed MW 90-120kDa

Applications

Reactivity Human
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples U-937, HeLa
Cellular location Cell membrane, Endosome membrane, Late endosome, Lysosome membrane, Single-pass type I membrane protein
Customer validation

WB (HEK293TMus musculus, Mus musculus, Homo sapiens, Rattus norvegicus, Sus scrofa)

IF (Homo sapiens, Sus scrofa, Rattus norvegicus)

IHC (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

LAMP1 Rabbit pAb images

ABclonal:Western blot - LAMP1 Rabbit pAb (A2582)}

Western blot - LAMP1 Rabbit pAb (A2582)

Western blot analysis of lysates from U-937 cells, using LAMP1 Rabbit pAb (A2582) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
ABclonal:Western blot - LAMP1 Rabbit pAb (A2582)}

Western blot - LAMP1 Rabbit pAb (A2582)

Western blot analysis of lysates from wild type(WT) and LAMP1 knockout (KO) HeLa cells, using LAMP1 Rabbit pAb (A2582) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Submit an review for A2582

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A2582 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on LAMP1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to LAMP1. (Distance between topics and target gene indicate popularity.) LAMP1

* Data provided by citexs.com, for reference only.

Publishing research using A2582? Please let us know so that we can cite the reference in this datasheet.

Antibodies (8)

Proteins (1)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

!OUT OF STOCK

See Below for Alternatives
Alternative Products
Contact us to order