Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

L3MBTL3 Rabbit pAb (A7289)

Review (1) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - L3MBTL3 Rabbit pAb (A7289)

Western blot analysis of lysates from Mouse lung, using L3MBTL3 Rabbit pAb (A7289) at 1:4000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

ABclonal:Immunohistochemistry - L3MBTL3 Rabbit pAb (A7289)

Immunohistochemistry analysis of L3MBTL3 in paraffin-embedded human breast cancer using L3MBTL3 Rabbit pAb (A7289) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - L3MBTL3 Rabbit pAb (A7289)

Immunohistochemistry analysis of L3MBTL3 in paraffin-embedded human esophageal cancer using L3MBTL3 Rabbit pAb (A7289) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Review
ABclonal: review for L3MBTL3 Rabbit pAb(A7289)

You may also interested in:

Overview

Product name L3MBTL3 Rabbit pAb
Catalog No. A7289
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a member of the malignant brain tumor (MBT) family of chromatin interacting transcriptional repressors. Members of this family function as methyl-lysine readers, which recognize methylated lysine residues on histone protein tails, and are associated with the repression of gene expression. The encoded protein may regulate hematopoiesis. Homozygous deletion of this gene has been observed in human patients with medulloblastoma.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-255 of human L3MBTL3 (NP_115814.1).
Sequence MTESASSTSGQEFDVFSVMDWKDGVGTLPGSDLKFRVNEFGALEVITDENEMENVKKATATTTWMVPTAQEAPTSPPSSRPVFPPAYWTSPPGCPTVFSEKTGMPFRLKDPVKVEGLQFCENCCQYGNVDECLSGGNYCSQNCARHIKDKDQKEERDVEEDNEEEDPKCSRKKKPKLSLKADTKEDGEERDDEMENKQDVRILRGSQRARRKRRGDSAVLKQGLPPKGKKAWCWASYLEEEKAVAVPAKLFKEHQ
Gene ID 84456
Swiss prot Q96JM7
Synonyms MBT1; MBT-1; L3MBTL3
Calculated MW 88kDa
Observed MW 100kDa

Applications

Reactivity Human, Mouse
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:2000 - 1:4000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples Mouse lung
Cellular location Nucleus
Customer validation

WB (Mouse testis)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

L3MBTL3 Rabbit pAb images

ABclonal:Western blot - L3MBTL3 Rabbit pAb (A7289)}

Western blot - L3MBTL3 Rabbit pAb (A7289)

Western blot analysis of lysates from Mouse lung, using L3MBTL3 Rabbit pAb (A7289) at 1:4000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
ABclonal:Immunohistochemistry - L3MBTL3 Rabbit pAb (A7289)}

Immunohistochemistry - L3MBTL3 Rabbit pAb (A7289)

Immunohistochemistry analysis of L3MBTL3 in paraffin-embedded human breast cancer using L3MBTL3 Rabbit pAb (A7289) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - L3MBTL3 Rabbit pAb (A7289)}

Immunohistochemistry - L3MBTL3 Rabbit pAb (A7289)

Immunohistochemistry analysis of L3MBTL3 in paraffin-embedded human esophageal cancer using L3MBTL3 Rabbit pAb (A7289) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Submit an review for A7289

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A7289 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on L3MBTL3. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to L3MBTL3. (Distance between topics and target gene indicate popularity.) L3MBTL3

* Data provided by citexs.com, for reference only.

Publishing research using A7289? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order