Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

[KO Validated] macroH2A.1 Rabbit pAb (A7045)

KO/KDValidated

Publication (1) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - [KO Validated] macroH2A.1 Rabbit pAb (A7045)

Western blot analysis of lysates from wild type (WT) and macroH2A.1 knockout (KO) 293T cells, using [KO Validated] macroH2A.1 Rabbit pAb (A7045) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunohistochemistry - [KO Validated] macroH2A.1 Rabbit pAb (A7045)

Immunohistochemistry analysis of macroH2A.1 in paraffin-embedded human kidney using [KO Validated] macroH2A.1 Rabbit pAb (A7045) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - [KO Validated] macroH2A.1 Rabbit pAb (A7045)

Immunohistochemistry analysis of macroH2A.1 in paraffin-embedded human kidney cancer using [KO Validated] macroH2A.1 Rabbit pAb (A7045) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - [KO Validated] macroH2A.1 Rabbit pAb (A7045)

Immunohistochemistry analysis of macroH2A.1 in paraffin-embedded human stomach using [KO Validated] macroH2A.1 Rabbit pAb (A7045) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - [KO Validated] macroH2A.1 Rabbit pAb (A7045)

Immunohistochemistry analysis of macroH2A.1 in paraffin-embedded mouse lung cancer using [KO Validated] macroH2A.1 Rabbit pAb (A7045) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - [KO Validated] macroH2A.1 Rabbit pAb (A7045)

Immunofluorescence analysis of U2OS cells using [KO Validated] macroH2A.1 Rabbit pAb (A7045). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name [KO Validated] macroH2A.1 Rabbit pAb
Catalog No. A7045
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene encodes a replication-independent histone that is a member of the histone H2A family. It replaces conventional H2A histones in a subset of nucleosomes where it represses transcription and participates in stable X chromosome inactivation. Alternative splicing results in multiple transcript variants encoding different isoforms.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 123-372 of human macroH2A.1 (NP_613258.2).
Sequence KLEAIITPPPAKKAKSPSQKKPVSKKAGGKKGARKSKKKQGEVSKAASADSTTEGTPADGFTVLSTKSLFLGQKLNLIHSEISNLAGFEVEAIINPTNADIDLKDDLGNTLEKKGGKEFVEAVLELRKKNGPLEVAGAAVSAGHGLPAKFVIHCNSPVWGADKCEELLEKTVKNCLALADDKKLKSIAFPSIGSGRNGFPKQTAAQLILKAISSYFVSTMSSSIKTVYFVLFDSESIGIYVQEMAKLDAN
Gene ID 9555
Swiss prot O75367
Synonyms H2A.y; H2A/y; H2AFY; mH2A1; H2AF12M; MACROH2A1.1; macroH2A1.2; .1
Calculated MW 39kDa
Observed MW 40kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:100
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples A-549, HeLa, Rat brain
Cellular location Chromosome, Nucleus
Customer validation

WB (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

[KO Validated] macroH2A.1 Rabbit pAb images

ABclonal:Western blot - [KO Validated] macroH2A.1 Rabbit pAb (A7045)}

Western blot - [KO Validated] macroH2A.1 Rabbit pAb (A7045)

Western blot analysis of lysates from wild type (WT) and macroH2A.1 knockout (KO) 293T cells, using [KO Validated] macroH2A.1 Rabbit pAb (A7045) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
ABclonal:Immunohistochemistry - [KO Validated] macroH2A.1 Rabbit pAb (A7045)}

Immunohistochemistry - [KO Validated] macroH2A.1 Rabbit pAb (A7045)

Immunohistochemistry analysis of macroH2A.1 in paraffin-embedded human kidney using [KO Validated] macroH2A.1 Rabbit pAb (A7045) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - [KO Validated] macroH2A.1 Rabbit pAb (A7045)}

Immunohistochemistry - [KO Validated] macroH2A.1 Rabbit pAb (A7045)

Immunohistochemistry analysis of macroH2A.1 in paraffin-embedded human kidney cancer using [KO Validated] macroH2A.1 Rabbit pAb (A7045) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - [KO Validated] macroH2A.1 Rabbit pAb (A7045)}

Immunohistochemistry - [KO Validated] macroH2A.1 Rabbit pAb (A7045)

Immunohistochemistry analysis of macroH2A.1 in paraffin-embedded human stomach using [KO Validated] macroH2A.1 Rabbit pAb (A7045) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - [KO Validated] macroH2A.1 Rabbit pAb (A7045)}

Immunohistochemistry - [KO Validated] macroH2A.1 Rabbit pAb (A7045)

Immunohistochemistry analysis of macroH2A.1 in paraffin-embedded mouse lung cancer using [KO Validated] macroH2A.1 Rabbit pAb (A7045) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - [KO Validated] macroH2A.1 Rabbit pAb (A7045)}

Immunofluorescence - [KO Validated] macroH2A.1 Rabbit pAb (A7045)

Immunofluorescence analysis of U2OS cells using [KO Validated] macroH2A.1 Rabbit pAb (A7045). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A7045 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on MACROH2A1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to MACROH2A1. (Distance between topics and target gene indicate popularity.) MACROH2A1

* Data provided by citexs.com, for reference only.

Publishing research using A7045? Please let us know so that we can cite the reference in this datasheet.

Antibodies (3)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order