KO/KDValidated PathoQIHC Pathology
Review (1) Publications (50) Datasheet SDS COA
Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Reactivity:Human, Mouse, Rat
Product name | [KO Validated] β-Catenin Rabbit mAb |
---|---|
Catalog No. | A19657 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0136 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human beta Catenin (P35222). |
---|---|
Sequence | MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTSQVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFP |
Gene ID | 1499 |
Swiss prot | P35222 |
Synonyms | EVR7; CTNNB; MRD19; NEDSDV; armadillo; in |
Calculated MW | 85kDa |
Observed MW | 92kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | Testing results |
IHC-P | |
WB | |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
Application key | Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation |
Positive samples | HeLa cells, 293T cells, NIH/3T3 cells, Mouse brain |
Cellular location | Cell junction, Cell membrane, Cytoplasm, Nucleus, adherens junction, centrosome, cytoskeleton, microtubule organizing center, spindle pole |
Customer validation | (normal mouse hippocampus) WB (Homo sapiens, Rattus norvegicus, Mus musculus, Mus musculus ) IF (Homo sapiens, Mus musculus) IHC (Homo sapiens, Mus musculus) IF (Mus musculus, Homo sapiens) IF (Homo sapiens, Mus musculus, Rattus norvegicus) WB (Mus musculus) Western Blot (Mus musculus) IHC (Homo sapiens, Rattus norvegicus, Mus musculus) RT-qPCR (Rattus norvegicus) Co-IP (Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com
Submit your question about A19657 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Based on existing publications, the following genes are closely related to research on CTNNB1. (Numbers indicate number of published articles where both targets appear.)
Based on existing publications, the following research topics are related to CTNNB1. (Distance between topics and target gene indicate popularity.) CTNNB1
* Data provided by citexs.com, for reference only.
Publishing research using A19657? Please let us know so that we can cite the reference in this datasheet.
* For research use only. Not for therapeutic or diagnostic purposes.