Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

[KO Validated] β-Catenin Rabbit mAb (A19657)

KO/KDValidated PathoQIHC Pathology

Review (1) Publications (50) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - [KO Validated] β-Catenin Rabbit mAb (A19657)

Western blot analysis of lysates from HeLa cells, using [KO Validated] β-Catenin Rabbit mAb (A19657) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Western blot - [KO Validated] β-Catenin Rabbit mAb (A19657)

Western blot analysis of lysates from Mouse brain, using [KO Validated] β-Catenin Rabbit mAb (A19657) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Western blot - [KO Validated] β-Catenin Rabbit mAb (A19657)

Western blot analysis of lysates from wild type (WT) and β-Catenin knockout (KO) 293T cells, using [KO Validated] β-Catenin Rabbit mAb (A19657) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Western blot - [KO Validated] β-Catenin Rabbit mAb (A19657)

Western blot analysis of lysates from NIH/3T3 cells, using [KO Validated] β-Catenin Rabbit mAb (A19657) at 1:1000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Western blot - [KO Validated] β-Catenin Rabbit mAb (A19657)

Western blot analysis of lysates from wild type(WT) and [KO Validated] β-Catenin knockout (KO) 293T(KO) cells, using [KO Validated] β-Catenin Rabbit mAb (A19657) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunohistochemistry - [KO Validated] β-Catenin Rabbit mAb (A19657)

Immunohistochemistry analysis of β-Catenin in paraffin-embedded human kidney using [KO Validated] β-Catenin Rabbit mAb (A19657) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - [KO Validated] β-Catenin Rabbit mAb (A19657)

Immunohistochemistry analysis of β-Catenin in paraffin-embedded human liver cancer using [KO Validated] β-Catenin Rabbit mAb (A19657) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - [KO Validated] β-Catenin Rabbit mAb (A19657)

Immunohistochemistry analysis of β-Catenin in paraffin-embedded human liver using [KO Validated] β-Catenin Rabbit mAb (A19657) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - [KO Validated] β-Catenin Rabbit mAb (A19657)

Immunohistochemistry analysis of β-Catenin in paraffin-embedded human thyroid cancer using [KO Validated] β-Catenin Rabbit mAb (A19657) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - [KO Validated] β-Catenin Rabbit mAb (A19657)

Immunofluorescence analysis of C6 cells using [KO Validated] β-Catenin Rabbit mAb (A19657) at dilution of 100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunoprecipitation - [KO Validated] β-Catenin Rabbit mAb (A19657)

Immunoprecipitation analysis of 600 μg extracts of Mouse brain using 3 μg β-Catenin antibody (A19657). Western blot was performed from the immunoprecipitate using β-Catenin (A19657) at a dilution of 1:1000.

Review
ABclonal: review for [KO Validated] β-Catenin Rabbit mAb(A19657)

You may also interested in:

Overview

Product name [KO Validated] β-Catenin Rabbit mAb
Catalog No. A19657
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC0136

Background

The protein encoded by this gene is part of a complex of proteins that constitute adherens junctions (AJs). AJs are necessary for the creation and maintenance of epithelial cell layers by regulating cell growth and adhesion between cells. The encoded protein also anchors the actin cytoskeleton and may be responsible for transmitting the contact inhibition signal that causes cells to stop dividing once the epithelial sheet is complete. Finally, this protein binds to the product of the APC gene, which is mutated in adenomatous polyposis of the colon. Mutations in this gene are a cause of colorectal cancer (CRC), pilomatrixoma (PTR), medulloblastoma (MDB), and ovarian cancer. Alternative splicing results in multiple transcript variants.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human beta Catenin (P35222).
Sequence MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTSQVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFP
Gene ID 1499
Swiss prot P35222
Synonyms EVR7; CTNNB; MRD19; NEDSDV; armadillo; in
Calculated MW 85kDa
Observed MW 92kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications Testing results
IHC-P Human
WB HumanMouseRat
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
  • IP 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    Immunoprecipitation    
Positive samples HeLa cells, 293T cells, NIH/3T3 cells, Mouse brain
Cellular location Cell junction, Cell membrane, Cytoplasm, Nucleus, adherens junction, centrosome, cytoskeleton, microtubule organizing center, spindle pole
Customer validation

(normal mouse hippocampus)

WB (Homo sapiens, Rattus norvegicus, Mus musculus, Mus musculus )

IF (Homo sapiens, Mus musculus)

IHC (Homo sapiens, Mus musculus)

IF (Mus musculus, Homo sapiens)

IF (Homo sapiens, Mus musculus, Rattus norvegicus)

WB (Mus musculus)

Western Blot (Mus musculus)

IHC (Homo sapiens, Rattus norvegicus, Mus musculus)

RT-qPCR (Rattus norvegicus)

Co-IP (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

[KO Validated] β-Catenin Rabbit mAb images

ABclonal:Western blot - [KO Validated] β-Catenin Rabbit mAb (A19657)}

Western blot - [KO Validated] β-Catenin Rabbit mAb (A19657)

Western blot analysis of lysates from HeLa cells, using [KO Validated] β-Catenin Rabbit mAb (A19657) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
ABclonal:Western blot - [KO Validated] β-Catenin Rabbit mAb (A19657)}

Western blot - [KO Validated] β-Catenin Rabbit mAb (A19657)

Western blot analysis of lysates from Mouse brain, using [KO Validated] β-Catenin Rabbit mAb (A19657) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
ABclonal:Western blot - [KO Validated] β-Catenin Rabbit mAb (A19657)}

Western blot - [KO Validated] β-Catenin Rabbit mAb (A19657)

Western blot analysis of lysates from wild type (WT) and β-Catenin knockout (KO) 293T cells, using [KO Validated] β-Catenin Rabbit mAb (A19657) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
ABclonal:Western blot - [KO Validated] β-Catenin Rabbit mAb (A19657)}

Western blot - [KO Validated] β-Catenin Rabbit mAb (A19657)

Western blot analysis of lysates from NIH/3T3 cells, using [KO Validated] β-Catenin Rabbit mAb (A19657) at 1:1000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
ABclonal:Western blot - [KO Validated] β-Catenin Rabbit mAb (A19657)}

Western blot - [KO Validated] β-Catenin Rabbit mAb (A19657)

Western blot analysis of lysates from wild type(WT) and [KO Validated] β-Catenin knockout (KO) 293T(KO) cells, using [KO Validated] β-Catenin Rabbit mAb (A19657) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
ABclonal:Immunohistochemistry - [KO Validated] β-Catenin Rabbit mAb (A19657)}

Immunohistochemistry - [KO Validated] β-Catenin Rabbit mAb (A19657)

Immunohistochemistry analysis of β-Catenin in paraffin-embedded human kidney using [KO Validated] β-Catenin Rabbit mAb (A19657) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - [KO Validated] β-Catenin Rabbit mAb (A19657)}

Immunohistochemistry - [KO Validated] β-Catenin Rabbit mAb (A19657)

Immunohistochemistry analysis of β-Catenin in paraffin-embedded human liver cancer using [KO Validated] β-Catenin Rabbit mAb (A19657) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - [KO Validated] β-Catenin Rabbit mAb (A19657)}

Immunohistochemistry - [KO Validated] β-Catenin Rabbit mAb (A19657)

Immunohistochemistry analysis of β-Catenin in paraffin-embedded human liver using [KO Validated] β-Catenin Rabbit mAb (A19657) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - [KO Validated] β-Catenin Rabbit mAb (A19657)}

Immunohistochemistry - [KO Validated] β-Catenin Rabbit mAb (A19657)

Immunohistochemistry analysis of β-Catenin in paraffin-embedded human thyroid cancer using [KO Validated] β-Catenin Rabbit mAb (A19657) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - [KO Validated] β-Catenin Rabbit mAb (A19657)}

Immunofluorescence - [KO Validated] β-Catenin Rabbit mAb (A19657)

Immunofluorescence analysis of C6 cells using [KO Validated] β-Catenin Rabbit mAb (A19657) at dilution of 100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunoprecipitation - [KO Validated] β-Catenin Rabbit mAb (A19657)}

Immunoprecipitation - [KO Validated] β-Catenin Rabbit mAb (A19657)

Immunoprecipitation analysis of 600 μg extracts of Mouse brain using 3 μg β-Catenin antibody (A19657). Western blot was performed from the immunoprecipitate using β-Catenin (A19657) at a dilution of 1:1000.

Submit an review for A19657

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A19657 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on CTNNB1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to CTNNB1. (Distance between topics and target gene indicate popularity.) CTNNB1

* Data provided by citexs.com, for reference only.

Publishing research using A19657? Please let us know so that we can cite the reference in this datasheet.

Antibodies (15)

Proteins (1)

ELISA Kits (1)

Secondary Antibodies (22)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order