Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

[KO Validated] c-Myc Rabbit mAb (A19032)

KO/KDValidated

Review (1) Publications (13) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal: - [KO Validated] c-Myc Rabbit mAb (A19032)

UT&Tag was performed using the CUT&Tag Assay Kit (pAG-Tn5) for Illumina(RK20265) from 10⁵ K562 cells with 1μg c-Myc Rabbit mAb(A19032), along with a Goat Anti-Rabbit IgG(H+L). The CUT&Tag results indicate the enrichment pattern of ESE1 in representative gene loci (NPM1), as shown in figure.

ABclonal:Western blot - [KO Validated] c-Myc Rabbit mAb (A19032)

Western blot analysis of various lysates using [KO Validated] c-Myc Rabbit mAb (A19032) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Western blot - [KO Validated] c-Myc Rabbit mAb (A19032)

Western blot analysis of lysates from Mouse ovary, using [KO Validated] c-Myc Rabbit mAb (A19032) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 3min.

ABclonal:Western blot - [KO Validated] c-Myc Rabbit mAb (A19032)

Western blot analysis of lysates from wild type (WT) and c-Myc knockout (KO) HCT 116 cells, using [KO Validated] c-Myc Rabbit mAb (A19032) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Chromatin Immunoprecipitation - [KO Validated] c-Myc Rabbit mAb (A19032)

Chromatin immunoprecipitation analysis of extracts of K562 cells, using c-Myc antibody (A19032) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.

Review
ABclonal: review for [KO Validated] c-Myc Rabbit mAb(A19032)

You may also interested in:

Overview

Product name [KO Validated] c-Myc Rabbit mAb
Catalog No. A19032
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC0412

Background

This gene is a proto-oncogene and encodes a nuclear phosphoprotein that plays a role in cell cycle progression, apoptosis and cellular transformation. The encoded protein forms a heterodimer with the related transcription factor MAX. This complex binds to the E box DNA consensus sequence and regulates the transcription of specific target genes. Amplification of this gene is frequently observed in numerous human cancers. Translocations involving this gene are associated with Burkitt lymphoma and multiple myeloma in human patients. There is evidence to show that translation initiates both from an upstream, in-frame non-AUG (CUG) and a downstream AUG start site, resulting in the production of two isoforms with distinct N-termini.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human c-Myc (P01106).
Sequence MPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFELLPTPPLSPSRRSGLCSPSYVAVTPFSLRGDNDGGGGSFSTADQLE
Gene ID 4609
Swiss prot P01106
Synonyms MRTL; MYCC; c-Myc; bHLHe39; yc
Calculated MW 51kDa
Observed MW 50-60kDa

Applications

Reactivity Human, Mouse
Tested applications Testing results
WB HumanMouse
Recommended dilution
  • WB 1:500 - 1:1000
  • ChIP 5μg antibody for 10μg-15μg of Chromatin
  • CUT&Tag 10⁵ cells /1 μg
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples Jurkat, MCF7, HCT 116, Mouse ovary
Cellular location Nucleus, nucleolus, nucleoplasm
Customer validation

(293T MOLT4 IGROV-1)

WB (Homo sapiens, Mus musculus, Cyprinus carpio)

IP (Homo sapiens)

ChIP (Arabidopsis thaliana, Homo sapiens)

qPCR (Homo sapiens)

Co-IP (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

[KO Validated] c-Myc Rabbit mAb images

ABclonal: - [KO Validated] c-Myc Rabbit mAb (A19032)}

- [KO Validated] c-Myc Rabbit mAb (A19032)

UT&Tag was performed using the CUT&Tag Assay Kit (pAG-Tn5) for Illumina(RK20265) from 10⁵ K562 cells with 1μg c-Myc Rabbit mAb(A19032), along with a Goat Anti-Rabbit IgG(H+L). The CUT&Tag results indicate the enrichment pattern of ESE1 in representative gene loci (NPM1), as shown in figure.
ABclonal:Western blot - [KO Validated] c-Myc Rabbit mAb (A19032)}

Western blot - [KO Validated] c-Myc Rabbit mAb (A19032)

Western blot analysis of various lysates using [KO Validated] c-Myc Rabbit mAb (A19032) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
ABclonal:Western blot - [KO Validated] c-Myc Rabbit mAb (A19032)}

Western blot - [KO Validated] c-Myc Rabbit mAb (A19032)

Western blot analysis of lysates from Mouse ovary, using [KO Validated] c-Myc Rabbit mAb (A19032) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 3min.
ABclonal:Western blot - [KO Validated] c-Myc Rabbit mAb (A19032)}

Western blot - [KO Validated] c-Myc Rabbit mAb (A19032)

Western blot analysis of lysates from wild type (WT) and c-Myc knockout (KO) HCT 116 cells, using [KO Validated] c-Myc Rabbit mAb (A19032) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
ABclonal:Chromatin Immunoprecipitation - [KO Validated] c-Myc Rabbit mAb (A19032)}

Chromatin Immunoprecipitation - [KO Validated] c-Myc Rabbit mAb (A19032)

Chromatin immunoprecipitation analysis of extracts of K562 cells, using c-Myc antibody (A19032) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.

Submit an review for A19032

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A19032 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on MYC. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to MYC. (Distance between topics and target gene indicate popularity.) MYC

* Data provided by citexs.com, for reference only.

Publishing research using A19032? Please let us know so that we can cite the reference in this datasheet.

Antibodies (11)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order