Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

[KO Validated] ZEB1 Rabbit pAb (A22244)

KO/KDValidated

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Rat

ABclonal:Western blot - [KO Validated] ZEB1 Rabbit pAb (A22244)

Western blot analysis of extracts from normal (control) and ZEB1 knockout (KO) HeLa cells, using ZEB1 antibody (A22244) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

ABclonal:Western blot - [KO Validated] ZEB1 Rabbit pAb (A22244)

Western blot analysis of various lysates, using ZEB1 antibody (A22244) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

You may also interested in:

Overview

Product name [KO Validated] ZEB1 Rabbit pAb
Catalog No. A22244
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a zinc finger transcription factor. The encoded protein likely plays a role in transcriptional repression of interleukin 2. Mutations in this gene have been associated with posterior polymorphous corneal dystrophy-3 and late-onset Fuchs endothelial corneal dystrophy. Alternatively spliced transcript variants encoding different isoforms have been described.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 800-900 of human ZEB1 (NP_110378.3).
Sequence INIAIPTVTAQLPTIVAIADQNSVPCLRALAANKQTILIPQVAYTYSTTVSPAVQEPPLKVIQPNGNQDERQDTSSEGVSNVEDQNDSDSTPPKKKMRKTE
Gene ID 6935
Swiss prot P37275
Synonyms BZP; TCF8; AREB6; FECD6; NIL2A; PPCD3; ZFHEP; ZFHX1A; DELTAEF1; B1
Calculated MW 124kDa
Observed MW 200kDa

Applications

Reactivity Human, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples HeLa, Jurkat, Rat heart
Cellular location cytosol, nucleoplasm, nucleus

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

[KO Validated] ZEB1 Rabbit pAb images

ABclonal:Western blot - [KO Validated] ZEB1 Rabbit pAb (A22244)}

Western blot - [KO Validated] ZEB1 Rabbit pAb (A22244)

Western blot analysis of extracts from normal (control) and ZEB1 knockout (KO) HeLa cells, using ZEB1 antibody (A22244) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
ABclonal:Western blot - [KO Validated] ZEB1 Rabbit pAb (A22244)}

Western blot - [KO Validated] ZEB1 Rabbit pAb (A22244)

Western blot analysis of various lysates, using ZEB1 antibody (A22244) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

Inquire About This Product

Submit your question about A22244 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on ZEB1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to ZEB1. (Distance between topics and target gene indicate popularity.) ZEB1

* Data provided by citexs.com, for reference only.

Publishing research using A22244? Please let us know so that we can cite the reference in this datasheet.

Antibodies (6)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order