Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

[KO Validated] VAT1 Rabbit pAb (A17077)

KO/KDValidated

Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - [KO Validated] VAT1 Rabbit pAb (A17077)

Western blot analysis of various lysates using [KO Validated] VAT1 Rabbit pAb (A17077) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5min.

ABclonal:Western blot - [KO Validated] VAT1 Rabbit pAb (A17077)

Western blot analysis of lysates from wild type (WT) and VAT1 knockout (KO) 293T cells, using [KO Validated] VAT1 Rabbit pAb (A17077) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunofluorescence - [KO Validated] VAT1 Rabbit pAb (A17077)

Immunofluorescence analysis of L929 cells using [KO Validated] VAT1 Rabbit pAb (A17077) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name [KO Validated] VAT1 Rabbit pAb
Catalog No. A17077
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Synaptic vesicles are responsible for regulating the storage and release of neurotransmitters in the nerve terminal. The protein encoded by this gene is an abundant integral membrane protein of cholinergic synaptic vesicles and is thought to be involved in vesicular transport. It belongs to the quinone oxidoreductase subfamily of zinc-containing alcohol dehydrogenase proteins.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-300 of human VAT1 (NP_006364.2).
Sequence GVGMAAVQLCRTVENVTVFGTASASKHEALKENGVTHPIDYHTTDYVDEIKKISPKGVDIVMDPLGGSDTAKGYNLLKPMGKVVTYGMANLLTGPKRNLMA
Gene ID 10493
Swiss prot Q99536
Synonyms VATI; T1
Calculated MW 42kDa
Observed MW 42kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples K-562, U-87MG, 293T
Cellular location extracellular exosome, extracellular region, mitochondrial outer membrane

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

[KO Validated] VAT1 Rabbit pAb images

ABclonal:Western blot - [KO Validated] VAT1 Rabbit pAb (A17077)}

Western blot - [KO Validated] VAT1 Rabbit pAb (A17077)

Western blot analysis of various lysates using [KO Validated] VAT1 Rabbit pAb (A17077) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5min.
ABclonal:Western blot - [KO Validated] VAT1 Rabbit pAb (A17077)}

Western blot - [KO Validated] VAT1 Rabbit pAb (A17077)

Western blot analysis of lysates from wild type (WT) and VAT1 knockout (KO) 293T cells, using [KO Validated] VAT1 Rabbit pAb (A17077) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
ABclonal:Immunofluorescence - [KO Validated] VAT1 Rabbit pAb (A17077)}

Immunofluorescence - [KO Validated] VAT1 Rabbit pAb (A17077)

Immunofluorescence analysis of L929 cells using [KO Validated] VAT1 Rabbit pAb (A17077) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A17077 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on VAT1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to VAT1. (Distance between topics and target gene indicate popularity.) VAT1

* Data provided by citexs.com, for reference only.

Publishing research using A17077? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order