Tested applications:WBIHCICCIFIPChIPChIP-seqRIPFCELISAMeDIPNucleotide ArrayDBFACSCoIPReactivity:Human, Mouse, Rat
Product name | [KO Validated] TTC11/FIS1 Rabbit mAb |
---|---|
Catalog No. | A19666 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-122 of human TTC11/FIS1 (NP_057152.2). |
---|---|
Sequence | MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDG |
Gene ID | 51024 |
Swiss prot | Q9Y3D6 |
Synonyms | CGI-135; TTC11; FIS1; TTC11 / FIS1; fission |
Calculated MW | 15kDa |
Observed MW | 15KDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHCICCIFIPChIPChIP-seqRIPFCELISAMeDIPNucleotide ArrayDBFACSCoIP |
Recommended dilution | WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200 IP 1:50 - 1:200 |
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Application key | Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation |
Positive samples | HeLa, HepG2, 293T, NIH/3T3, Mouse liver, Rat liver |
Cellular location | Mitochondrion outer membrane, Peroxisome membrane, Single-pass membrane protein |
Customer validation | WB(Mus musculus) |
Submit your question about A19666 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Publishing research using A19666? Please let us know so that we can cite the reference in this datasheet.
* For research use only. Not for therapeutic or diagnostic purposes.