Products > Catalog Antibodies > Monoclonal Antibodies

[KO Validated] TTC11/FIS1 Rabbit mAb (A19666)

Tested applications:WB IHC ICC IF IP ChIP ChIP-seq RIP FC ELISA MeDIP Nucleotide Array DB FACS CoIPReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using TTC11/FIS1 antibody (A19666) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

Western blot analysis of extracts from normal (control) and TTC11/FIS1 knockout (KO) HeLa cells, using TTC11/FIS1 antibody (A19666) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunohistochemistry - [KO Validated] TTC11/FIS1 Rabbit mAb (A19666)

Immunohistochemistry of paraffin-embedded rat brain using TTC11/FIS1 antibody (A19666) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry of paraffin-embedded human lung cancer using TTC11/FIS1 antibody (A19666) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry of paraffin-embedded mouse kidney using TTC11/FIS1 antibody (A19666) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - [KO Validated] TTC11/FIS1 Rabbit mAb (A19666)

Immunofluorescence analysis of NIH-3T3 cells using TTC11/FIS1 antibody (A19666). Blue: DAPI for nuclear staining.

ABclonal:Immunoprecipitation - [KO Validated] TTC11/FIS1 Rabbit mAb (A19666)

Immunoprecipitation analysis of 300ug extracts of HeLa cells using 3ug TTC11/FIS1 antibody (A19666). Western blot was performed from the immunoprecipitate using TTC11/FIS1 antibody (A19666) at a dilition of 1:1000.

Overview

Product name	[KO Validated] TTC11/FIS1 Rabbit mAb
Catalog No.	A19666
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The balance between fission and fusion regulates the morphology of mitochondria. TTC11 is a component of a mitochondrial complex that promotes mitochondrial fission (James et al., 2003 [PubMed 12783892]).[supplied by OMIM, Mar 2008]

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-122 of human TTC11/FIS1 (NP_057152.2).
Sequence	MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDG
Gene ID	51024
Swiss prot	Q9Y3D6
Synonyms	CGI-135; TTC11; FIS1; TTC11 / FIS1; fission
Calculated MW	15kDa
Observed MW	15KDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC ICC IF IP ChIP ChIP-seq RIP FC ELISA MeDIP Nucleotide Array DB FACS CoIP
Recommended dilution	WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200 IP 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key	Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation
Positive samples	HeLa, HepG2, 293T, NIH/3T3, Mouse liver, Rat liver
Cellular location	Mitochondrion outer membrane, Peroxisome membrane, Single-pass membrane protein
Customer validation	WB(Mus musculus)