Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

[KO Validated] Src Rabbit mAb (A19119)

KO/KDValidated

Publications (8) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - [KO Validated] Src Rabbit mAb (A19119)

Western blot analysis of various lysates using [KO Validated] Src Rabbit mAb (A19119) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Western blot - [KO Validated] Src Rabbit mAb (A19119)

Western blot analysis of lysates from wild type (WT) and Src knockout (KO) HeLa cells, using [KO Validated] Src Rabbit mAb (A19119) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1min.

ABclonal:Western blot - [KO Validated] Src Rabbit mAb (A19119)

Western blot analysis of lysates from Jurkat cells, using [KO Validated] Src Rabbit mAb (A19119) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1min.

ABclonal:Immunofluorescence - [KO Validated] Src Rabbit mAb (A19119)

Confocal imaging of A549 cells using [KO Validated] Src Rabbit mAb (A19119, at dilution of 1:100) (Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 100x.

ABclonal:Immunofluorescence - [KO Validated] Src Rabbit mAb (A19119)

Confocal imaging of NIH/3T3 cells using [KO Validated] Src Rabbit mAb (A19119, at dilution of 1:100) (Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 100x.

ABclonal:Immunoprecipitation - [KO Validated] Src Rabbit mAb (A19119)

Immunoprecipitation analysis of 600 μg extracts of Mouse brain using 3 μg Src antibody (A19119). Western blot was performed from the immunoprecipitate using Src antibody (A19119) at a dilution of 1:1000.

You may also interested in:

Overview

Product name [KO Validated] Src Rabbit mAb
Catalog No. A19119
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC0378

Background

This gene is highly similar to the v-src gene of Rous sarcoma virus. This proto-oncogene may play a role in the regulation of embryonic development and cell growth. The protein encoded by this gene is a tyrosine-protein kinase whose activity can be inhibited by phosphorylation by c-SRC kinase. Mutations in this gene could be involved in the malignant progression of colon cancer. Two transcript variants encoding the same protein have been found for this gene.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Src (P12931).
Sequence MGSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSKPASADGHRGPSAAFAPAAAEPKLFGGFNSSDTVTSPQRAGPLAGGVTTFVALYDYESRTE
Gene ID 6714
Swiss prot P12931
Synonyms ASV; SRC1; THC6; c-SRC; p60-Src; rc
Calculated MW 60kDa
Observed MW 60kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications Testing results
WB HumanMouseRat
IF/ICC Mouse
Recommended dilution
  • WB 1:500 - 1:2000
  • IF/ICC 1:50 - 1:200
  • IP 0.5μg-4μg antibody for 400μg-600μg extracts of whole cells
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    Immunoprecipitation    
Positive samples HeLa, Jurkat, Mouse brain, Mouse lung, Rat brain
Cellular location Cell membrane, Cytoplasm, Mitochondrion inner membrane, Nucleus, cytoskeleton
Customer validation

WB (Homo sapiens, Rattus norvegicus, Mus musculus)

IF (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

[KO Validated] Src Rabbit mAb images

ABclonal:Western blot - [KO Validated] Src Rabbit mAb (A19119)}

Western blot - [KO Validated] Src Rabbit mAb (A19119)

Western blot analysis of various lysates using [KO Validated] Src Rabbit mAb (A19119) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
ABclonal:Western blot - [KO Validated] Src Rabbit mAb (A19119)}

Western blot - [KO Validated] Src Rabbit mAb (A19119)

Western blot analysis of lysates from wild type (WT) and Src knockout (KO) HeLa cells, using [KO Validated] Src Rabbit mAb (A19119) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1min.
ABclonal:Western blot - [KO Validated] Src Rabbit mAb (A19119)}

Western blot - [KO Validated] Src Rabbit mAb (A19119)

Western blot analysis of lysates from Jurkat cells, using [KO Validated] Src Rabbit mAb (A19119) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1min.
ABclonal:Immunofluorescence - [KO Validated] Src Rabbit mAb (A19119)}

Immunofluorescence - [KO Validated] Src Rabbit mAb (A19119)

Confocal imaging of A549 cells using [KO Validated] Src Rabbit mAb (A19119, at dilution of 1:100) (Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 100x.
ABclonal:Immunofluorescence - [KO Validated] Src Rabbit mAb (A19119)}

Immunofluorescence - [KO Validated] Src Rabbit mAb (A19119)

Confocal imaging of NIH/3T3 cells using [KO Validated] Src Rabbit mAb (A19119, at dilution of 1:100) (Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 100x.
ABclonal:Immunoprecipitation - [KO Validated] Src Rabbit mAb (A19119)}

Immunoprecipitation - [KO Validated] Src Rabbit mAb (A19119)

Immunoprecipitation analysis of 600 μg extracts of Mouse brain using 3 μg Src antibody (A19119). Western blot was performed from the immunoprecipitate using Src antibody (A19119) at a dilution of 1:1000.

Inquire About This Product

Submit your question about A19119 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on SRC. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to SRC. (Distance between topics and target gene indicate popularity.) SRC

* Data provided by citexs.com, for reference only.

Publishing research using A19119? Please let us know so that we can cite the reference in this datasheet.

Antibodies (7)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order