Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

[KO Validated] Smad4 Rabbit mAb (A19116)

KO/KDValidated PathoQIHC Pathology

Publications (8) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal: - [KO Validated] Smad4 Rabbit mAb (A19116)

CUT&Tag was performed using the CUT&Tag Assay Kit (pAG-Tn5) for Illumina(RK20265) from 10⁵ K562 cells with 1μg Smad4 Rabbit mAb(A19116), along with a Goat Anti-Rabbit IgG(H+L). The CUT&Tag results indicate the enrichment pattern of Smad4 in representative gene loci (JUNB), as shown in figure.

ABclonal:Western blot - [KO Validated] Smad4 Rabbit mAb (A19116)

Western blot analysis of various lysates using [KO Validated] Smad4 Rabbit mAb (A19116) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Western blot - [KO Validated] Smad4 Rabbit mAb (A19116)

Western blot analysis of various lysates using [KO Validated] Smad4 Rabbit mAb (A19116) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.

ABclonal:Immunohistochemistry - [KO Validated] Smad4 Rabbit mAb (A19116)

Immunohistochemistry analysis of Smad4 in paraffin-embedded human liver cancer using [KO Validated] Smad4 Rabbit mAb (A19116) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

ABclonal:Immunoprecipitation - [KO Validated] Smad4 Rabbit mAb (A19116)

Immunoprecipitation analysis of 300 μg extracts of 293T cells using 3 μg Smad4 antibody (A19116). Western blot was performed from the immunoprecipitate using Smad4 antibody (A19116) at a dilution of1:1000.

ABclonal:Chromatin Immunoprecipitation - [KO Validated] Smad4 Rabbit mAb (A19116)

Chromatin immunoprecipitation analysis of extracts of HepG2 cells, using [KO Validated] Smad4 Rabbit mAb (A19116) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.

You may also interested in:

Overview

Product name [KO Validated] Smad4 Rabbit mAb
Catalog No. A19116
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC5009-06

Background

This gene encodes a member of the Smad family of signal transduction proteins. Smad proteins are phosphorylated and activated by transmembrane serine-threonine receptor kinases in response to transforming growth factor (TGF)-beta signaling. The product of this gene forms homomeric complexes and heteromeric complexes with other activated Smad proteins, which then accumulate in the nucleus and regulate the transcription of target genes. This protein binds to DNA and recognizes an 8-bp palindromic sequence (GTCTAGAC) called the Smad-binding element (SBE). The protein acts as a tumor suppressor and inhibits epithelial cell proliferation. It may also have an inhibitory effect on tumors by reducing angiogenesis and increasing blood vessel hyperpermeability. The encoded protein is a crucial component of the bone morphogenetic protein signaling pathway. The Smad proteins are subject to complex regulation by post-translational modifications. Mutations or deletions in this gene have been shown to result in pancreatic cancer, juvenile polyposis syndrome, and hereditary hemorrhagic telangiectasia syndrome.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 320-552 of human Smad4 (NP_005350.1).
Sequence PEYWCSIAYFEMDVQVGETFKVPSSCPIVTVDGYVDPSGGDRFCLGQLSNVHRTEAIERARLHIGKGVQLECKGEGDVWVRCLSDHAVFVQSYYLDREAGRAPGDAVHKIYPSAYIKVFDLRQCHRQMQQQAATAQAAAAAQAAAVAGNIPGPGSVGGIAPAISLSAAAGIGVDDLRRLCILRMSFVKGWGPDYPRQSIKETPCWIEIHLHRALQLLDEVLHTMPIADPQPLD
Gene ID 4089
Swiss prot Q13485
Synonyms JIP; DPC4; MADH4; MYHRS; d4
Calculated MW 60kDa
Observed MW 70kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications Testing results
IHC-P Human
WB HumanMouseRat
Recommended dilution
  • WB 1:500 - 1:2000
  • IHC-P 1:50 - 1:200
  • IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
  • ChIP 5μg antibody for 10μg-15μg of Chromatin
  • CUT&Tag 10⁵ cells /1 μg
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunoprecipitation    
Positive samples 293T, HCT 116, HepG2, C6, NIH/3T3, Mouse lung
Cellular location Cytoplasm, Nucleus
Customer validation

WB (Mus musculus, Homo sapiens)

IB (Homo sapiens)

IHC (Mus musculus)

Co-IP (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

[KO Validated] Smad4 Rabbit mAb images

ABclonal: - [KO Validated] Smad4 Rabbit mAb (A19116)}

- [KO Validated] Smad4 Rabbit mAb (A19116)

CUT&Tag was performed using the CUT&Tag Assay Kit (pAG-Tn5) for Illumina(RK20265) from 10⁵ K562 cells with 1μg Smad4 Rabbit mAb(A19116), along with a Goat Anti-Rabbit IgG(H+L). The CUT&Tag results indicate the enrichment pattern of Smad4 in representative gene loci (JUNB), as shown in figure.
ABclonal:Western blot - [KO Validated] Smad4 Rabbit mAb (A19116)}

Western blot - [KO Validated] Smad4 Rabbit mAb (A19116)

Western blot analysis of various lysates using [KO Validated] Smad4 Rabbit mAb (A19116) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
ABclonal:Western blot - [KO Validated] Smad4 Rabbit mAb (A19116)}

Western blot - [KO Validated] Smad4 Rabbit mAb (A19116)

Western blot analysis of various lysates using [KO Validated] Smad4 Rabbit mAb (A19116) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.
ABclonal:Immunohistochemistry - [KO Validated] Smad4 Rabbit mAb (A19116)}

Immunohistochemistry - [KO Validated] Smad4 Rabbit mAb (A19116)

Immunohistochemistry analysis of Smad4 in paraffin-embedded human liver cancer using [KO Validated] Smad4 Rabbit mAb (A19116) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
ABclonal:Immunoprecipitation - [KO Validated] Smad4 Rabbit mAb (A19116)}

Immunoprecipitation - [KO Validated] Smad4 Rabbit mAb (A19116)

Immunoprecipitation analysis of 300 μg extracts of 293T cells using 3 μg Smad4 antibody (A19116). Western blot was performed from the immunoprecipitate using Smad4 antibody (A19116) at a dilution of1:1000.
ABclonal:Chromatin Immunoprecipitation - [KO Validated] Smad4 Rabbit mAb (A19116)}

Chromatin Immunoprecipitation - [KO Validated] Smad4 Rabbit mAb (A19116)

Chromatin immunoprecipitation analysis of extracts of HepG2 cells, using [KO Validated] Smad4 Rabbit mAb (A19116) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.

Inquire About This Product

Submit your question about A19116 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on SMAD4. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to SMAD4. (Distance between topics and target gene indicate popularity.) SMAD4

* Data provided by citexs.com, for reference only.

Publishing research using A19116? Please let us know so that we can cite the reference in this datasheet.

Antibodies (2)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order