KO/KDValidated PathoQIHC Pathology
Publications (8) Datasheet COA
Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Reactivity:Human, Mouse, Rat
Product name | [KO Validated] Smad4 Rabbit mAb |
---|---|
Catalog No. | A19116 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC5009-06 |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 320-552 of human Smad4 (NP_005350.1). |
---|---|
Sequence | PEYWCSIAYFEMDVQVGETFKVPSSCPIVTVDGYVDPSGGDRFCLGQLSNVHRTEAIERARLHIGKGVQLECKGEGDVWVRCLSDHAVFVQSYYLDREAGRAPGDAVHKIYPSAYIKVFDLRQCHRQMQQQAATAQAAAAAQAAAVAGNIPGPGSVGGIAPAISLSAAAGIGVDDLRRLCILRMSFVKGWGPDYPRQSIKETPCWIEIHLHRALQLLDEVLHTMPIADPQPLD |
Gene ID | 4089 |
Swiss prot | Q13485 |
Synonyms | JIP; DPC4; MADH4; MYHRS; d4 |
Calculated MW | 60kDa |
Observed MW | 70kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | Testing results |
IHC-P | |
WB | |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 0.05% BSA, 50% glycerol, pH7.3. |
Application key | Western blotting Immunohistochemistry Immunoprecipitation |
Positive samples | 293T, HCT 116, HepG2, C6, NIH/3T3, Mouse lung |
Cellular location | Cytoplasm, Nucleus |
Customer validation | WB (Mus musculus, Homo sapiens) IB (Homo sapiens) IHC (Mus musculus) Co-IP (Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
Submit your question about A19116 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Based on existing publications, the following genes are closely related to research on SMAD4. (Numbers indicate number of published articles where both targets appear.)
Based on existing publications, the following research topics are related to SMAD4. (Distance between topics and target gene indicate popularity.) SMAD4
* Data provided by citexs.com, for reference only.
Publishing research using A19116? Please let us know so that we can cite the reference in this datasheet.
* For research use only. Not for therapeutic or diagnostic purposes.