Products > Catalog Antibodies > Monoclonal Antibodies

[KO Validated] Smad3 Rabbit mAb (A19115)

Tested applications:WB IHC ICC IF IP ChIP ChIP-seq RIP FC ELISA MeDIP Nucleotide Array DB FACS CoIPReactivity:Human, Mouse, Rat

Western blot analysis of extracts from wild type (WT) and Smad3 knockout (KO) 293T cells, using Smad3 antibody (A19115) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Western blot analysis of extracts of A-431 cells, using Smad3 antibody (A19115) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunohistochemistry - [KO Validated] Smad3 Rabbit mAb (A19115)

Immunohistochemistry of paraffin-embedded human liver using Smad3 Rabbit mAb (A19115) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - [KO Validated] Smad3 Rabbit mAb (A19115)

Immunofluorescence analysis of NIH-3T3 cells using [KO Validated] Smad3 Rabbit mAb (A19115) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

ABclonal:Immunoprecipitation - [KO Validated] Smad3 Rabbit mAb (A19115)

Immunoprecipitation analysis of 300ug extracts of A-431 cells using 3ug Smad3 antibody (A19115). Western blot was performed from the immunoprecipitate using Smad3 antibody (A19115) at a dilition of 1:500.

Overview

Product name	[KO Validated] Smad3 Rabbit mAb
Catalog No.	A19115
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The protein encoded by this gene belongs to the SMAD, a family of proteins similar to the gene products of the Drosophila gene 'mothers against decapentaplegic' (Mad) and the C. elegans gene Sma. SMAD proteins are signal transducers and transcriptional modulators that mediate multiple signaling pathways. This protein functions as a transcriptional modulator activated by transforming growth factor-beta and is thought to play a role in the regulation of carcinogenesis. [provided by RefSeq, Apr 2009]

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 200-300 of human Smad3 (P84022).
Sequence	MDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIG
Gene ID	4088
Swiss prot	P84022
Synonyms	HSPC193; HsT17436; JV15-2; LDS1C; LDS3; MADH3; SMAD3
Calculated MW	48kDa
Observed MW	52kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC ICC IF IP ChIP ChIP-seq RIP FC ELISA MeDIP Nucleotide Array DB FACS CoIP
Recommended dilution	WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200 IP 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key	Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation
Positive samples	A-431, 293T
Cellular location	Cytoplasm, Nucleus
Customer validation	WB(Mus musculus, Rattus norvegicus)

Research Area

[KO Validated] Smad3 Rabbit mAb images

Western blot - [KO Validated] Smad3 Rabbit mAb (A19115)

Immunohistochemistry - [KO Validated] Smad3 Rabbit mAb (A19115)

Immunofluorescence - [KO Validated] Smad3 Rabbit mAb (A19115)

Immunofluorescence analysis of NIH-3T3 cells using [KO Validated] Smad3 Rabbit mAb (A19115) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunoprecipitation - [KO Validated] Smad3 Rabbit mAb (A19115)