Tested applications:WBIHCICCIFIPChIPChIP-seqRIPFCELISAMeDIPNucleotide ArrayDBFACSCoIPReactivity:Human, Mouse, Rat
Product name | [KO Validated] Smad3 Rabbit mAb |
---|---|
Catalog No. | A19115 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human Smad3 (P84022). |
---|---|
Sequence | MDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIG |
Gene ID | 4088 |
Swiss prot | P84022 |
Synonyms | HSPC193; HsT17436; JV15-2; LDS1C; LDS3; MADH3; SMAD3 |
Calculated MW | 48kDa |
Observed MW | 52kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHCICCIFIPChIPChIP-seqRIPFCELISAMeDIPNucleotide ArrayDBFACSCoIP |
Recommended dilution | WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200 IP 1:50 - 1:200 |
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Application key | Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation |
Positive samples | A-431, 293T |
Cellular location | Cytoplasm, Nucleus |
Customer validation | WB(Mus musculus, Rattus norvegicus) |
Submit your question about A19115 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Publishing research using A19115? Please let us know so that we can cite the reference in this datasheet.
* For research use only. Not for therapeutic or diagnostic purposes.