Review (1)Publications (55) Datasheet SDS COA
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPFCMCUT&TagmeRIPInhibition
Reactivity:Human, Mouse, Rat
Product name | SQSTM1/p62 Rabbit mAb |
---|---|
Catalog No. | A19700 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0180 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 341-440 of human SQSTM1/p62 (Q13501). |
---|---|
Sequence | LSSKEVDPSTGELQSLQMPESEGPSSLDPSQEGPTGLKEAALYPHLPPEADPRLIESLSQMLSMGFSDEGGWLTRLLQTKNYDIGAALDTIQYSKHPPPL |
Gene ID | 8878 |
Swiss prot | Q13501 |
Synonyms | p60; p62; A170; DMRV; OSIL; PDB3; ZIP3; p62B; NADGP; FTDALS3 |
Calculated MW | 48kDa |
Observed MW | 62kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | Testing results |
IF/ICC | |
IHC-P | |
WB | |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Application key | Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation |
Positive samples | 293T, HeLa, L929, C2C12, PC-12 |
Cellular location | Cytoplasm, Cytoplasmic vesicle, Endoplasmic reticulum, Late endosome, Lysosome, Nucleus, P-body, autophagosome |
Customer validation | (HeLa、PC-3、U2-OS、293T) WB(Mus musculus, Homo sapiens, Rattus norvegicus, Gallus gallus, Sus scrofa, Human) IHC(Mus musculus) IF(Homo sapiens, Sus scrofa, Mus musculus) IF(Mus musculus,Homo sapiens) WB(Mus musculus,Homo sapiens) IP(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com
Submit your question about A19700 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Based on existing publications, the following genes are closely related to research on SQSTM1. (Numbers indicate number of published articles where both targets appear.)
Based on existing publications, the following research topics are related to SQSTM1. (Distance between topics and target gene indicate popularity.) SQSTM1
* Data provided by citexs.com, for reference only.
Publishing research using A19700? Please let us know so that we can cite the reference in this datasheet.
* For research use only. Not for therapeutic or diagnostic purposes.