Tested applications:WBIHCICCIFIPChIPChIP-seqRIPFCELISAMeDIPNucleotide ArrayDBFACSCoIPReactivity:Human, Mouse, Rat
Product name | [KO Validated] SQSTM1/p62 Rabbit mAb |
---|---|
Catalog No. | A19700 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 341-440 of human SQSTM1/p62 (Q13501). |
---|---|
Sequence | LSSKEVDPSTGELQSLQMPESEGPSSLDPSQEGPTGLKEAALYPHLPPEADPRLIESLSQMLSMGFSDEGGWLTRLLQTKNYDIGAALDTIQYSKHPPPL |
Gene ID | 8878 |
Swiss prot | Q13501 |
Synonyms | SQSTM1; A170; DMRV; FTDALS3; NADGP; OSIL; PDB3; ZIP3; p60; p62; p62B |
Calculated MW | 62kDa |
Observed MW | 62KDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHCICCIFIPChIPChIP-seqRIPFCELISAMeDIPNucleotide ArrayDBFACSCoIP |
Recommended dilution | WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200 IP 1:50 - 1:200 |
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Application key | Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation |
Positive samples | 293T, HeLa, L929, C2C12, PC-12 |
Cellular location | Cytoplasm, Cytoplasmic vesicle, Endoplasmic reticulum, Late endosome, Lysosome, Nucleus, P-body, autophagosome |
Customer validation | (HeLa、PC-3、U2-OS、293T) WB(Mus musculus, Homo sapiens, Rattus norvegicus, Gallus gallus, Sus scrofa) IHC(Mus musculus) IF(Homo sapiens, Sus scrofa) |
Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com
Submit your question about A19700 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Publishing research using A19700? Please let us know so that we can cite the reference in this datasheet.
* For research use only. Not for therapeutic or diagnostic purposes.