Product name | [KO Validated] SMARCC1 Rabbit pAb |
---|---|
Catalog No. | A6128 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 80-320 of human SMARCC1 (NP_003065.3). |
---|---|
Sequence | LVVQLLQFQEDAFGKHVTNPAFTKLPAKCFMDFKAGGALCHILGAAYKYKNEQGWRRFDLQNPSRMDRNVEMFMNIEKTLVQNNCLTRPNIYLIPDIDLKLANKLKDIIKRHQGTFTDEKSKASHHIYPYSSSQDDEEWLRPVMRKEKQVLVHWGFYPDSYDTWVHSNDVDAEIEDPPIPEKPWKVHVKWILDTDIFNEWMNEEDYEVDENRKPVSFRQRISTKNEEPVRSPERRDRKASA |
Gene ID | 6599 |
Swiss prot | Q92922 |
Synonyms | SMARCC1; BAF155; CRACC1; Rsc8; SRG3; SWI3 |
Calculated MW | 122kDa |
Observed MW | 155KDa |
Reactivity | Human |
---|---|
Tested applications | WBIHCICCIFIPChIPChIPseqRIPFCELISAMeDIPNucleotide ArrayDB |
Recommended dilution | WB 1:500 - 1:2000 IHC 1:50 - 1:200 IP 1:50 - 1:200 |
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Application key | Western blotting Immunohistochemistry Immunoprecipitation |
Positive samples | 293T |
Cellular location | Nucleus |
Submit your question about A6128 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.