Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

[KO Validated] BRG1/SMARCA4 Rabbit pAb (A0887)

KO/KDValidated

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human

ABclonal:Western blot - [KO Validated] BRG1/SMARCA4 Rabbit pAb (A0887)

Western blot analysis of extracts of various cell lines, using BRG1/BRG1/SMARCA4 antibody (A0887) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.

ABclonal:Western blot - [KO Validated] BRG1/SMARCA4 Rabbit pAb (A0887)

Western blot analysis of extracts from normal (control) and BRG1/BRG1/SMARCA4 knockout (KO) 293T cells, using BRG1/BRG1/SMARCA4 antibody (A0887) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunofluorescence - [KO Validated] BRG1/SMARCA4 Rabbit pAb (A0887)

Immunofluorescence analysis of HeLa cells using BRG1/BRG1/SMARCA4 antibody (A0887).

You may also interested in:

Overview

Product name [KO Validated] BRG1/SMARCA4 Rabbit pAb
Catalog No. A0887
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The protein encoded by this gene is a member of the SWI/SNF family of proteins and is similar to the brahma protein of Drosophila. Members of this family have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein is part of the large ATP-dependent chromatin remodeling complex SNF/SWI, which is required for transcriptional activation of genes normally repressed by chromatin. In addition, this protein can bind BRCA1, as well as regulate the expression of the tumorigenic protein CD44. Mutations in this gene cause rhabdoid tumor predisposition syndrome type 2. Multiple transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 30-130 of human BRG1/BRG1/SMARCA4 (NP_003063.2).
Sequence PSPGPSPGSAHSMMGPSPGPPSAGHPIPTQGPGGYPQDNMHQMHKPMESMHEKGMSDDPRYNQMKGMGMRSGGHAGMGPPPSPMDQHSQGYPSPLGGSEHA
Gene ID 6597
Swiss prot P51532
Synonyms BRG1; CSS4; SNF2; SWI2; MRD16; RTPS2; BAF190; SNF2L4; SNF2LB; hSNF2b; BAF190A; SNF2-beta; A4
Calculated MW 185kDa
Observed MW 180kDa

Applications

Reactivity Human
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IF/ICC 1:20 - 1:50
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples OVCAR3, HeLa
Cellular location Nucleus

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

[KO Validated] BRG1/SMARCA4 Rabbit pAb images

ABclonal:Western blot - [KO Validated] BRG1/SMARCA4 Rabbit pAb (A0887)}

Western blot - [KO Validated] BRG1/SMARCA4 Rabbit pAb (A0887)

Western blot analysis of extracts of various cell lines, using BRG1/BRG1/SMARCA4 antibody (A0887) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
ABclonal:Western blot - [KO Validated] BRG1/SMARCA4 Rabbit pAb (A0887)}

Western blot - [KO Validated] BRG1/SMARCA4 Rabbit pAb (A0887)

Western blot analysis of extracts from normal (control) and BRG1/BRG1/SMARCA4 knockout (KO) 293T cells, using BRG1/BRG1/SMARCA4 antibody (A0887) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
ABclonal:Immunofluorescence - [KO Validated] BRG1/SMARCA4 Rabbit pAb (A0887)}

Immunofluorescence - [KO Validated] BRG1/SMARCA4 Rabbit pAb (A0887)

Immunofluorescence analysis of HeLa cells using BRG1/BRG1/SMARCA4 antibody (A0887).

Inquire About This Product

Submit your question about A0887 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on SMARCA4. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to SMARCA4. (Distance between topics and target gene indicate popularity.) SMARCA4

* Data provided by citexs.com, for reference only.

Publishing research using A0887? Please let us know so that we can cite the reference in this datasheet.

Antibodies (2)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order