Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

[KO Validated] SIRT3 Rabbit mAb (A20805)

KO/KDValidated

Publications (4) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - [KO Validated] SIRT3 Rabbit mAb (A20805)

Western blot analysis of various lysates, using [KO Validated] SIRT3 Rabbit mAb (A20805) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunohistochemistry - [KO Validated] SIRT3 Rabbit mAb (A20805)

Immunohistochemistry analysis of SIRT3 in paraffin-embedded mouse kidney using [KO Validated] SIRT3 Rabbit mAb (A20805) at dilution of 1:100(40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunoprecipitation - [KO Validated] SIRT3 Rabbit mAb (A20805)

Immunoprecipitation analysis of 300ug extracts of Hela cells using 3ug SIRT3 Rabbit mAb (A20805). Western blot was performed from the immunoprecipitate using SIRT3 Rabbit mAb (A20805) at a dilition of 1:1000.

You may also interested in:

Overview

Product name [KO Validated] SIRT3 Rabbit mAb
Catalog No. A20805
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC51526

Background

SIRT3 encodes a member of the sirtuin family of class III histone deacetylases, homologs to the yeast Sir2 protein. The encoded protein is found exclusively in mitochondria, where it can eliminate reactive oxygen species, inhibit apoptosis, and prevent the formation of cancer cells. SIRT3 has far-reaching effects on nuclear gene expression, cancer, cardiovascular disease, neuroprotection, aging, and metabolic control.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 300-399 of human SIRT3 (NP_036371.1).
Sequence QRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRETGKLDGPDK
Gene ID 23410
Swiss prot Q9NTG7
Synonyms SIR2L3; T3
Calculated MW 44kDa
Observed MW 28kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications Testing results
WB HumanRat
IHC-P Mouse
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
  • IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunoprecipitation    
Positive samples HeLa, HepG2, Rat liver
Cellular location Mitochondrion matrix
Customer validation

WB (Rattus norvegicus, Mus musculus, Homo sapiens)

IHC (Rattus norvegicus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

[KO Validated] SIRT3 Rabbit mAb images

ABclonal:Western blot - [KO Validated] SIRT3 Rabbit mAb (A20805)}

Western blot - [KO Validated] SIRT3 Rabbit mAb (A20805)

Western blot analysis of various lysates, using [KO Validated] SIRT3 Rabbit mAb (A20805) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
ABclonal:Immunohistochemistry - [KO Validated] SIRT3 Rabbit mAb (A20805)}

Immunohistochemistry - [KO Validated] SIRT3 Rabbit mAb (A20805)

Immunohistochemistry analysis of SIRT3 in paraffin-embedded mouse kidney using [KO Validated] SIRT3 Rabbit mAb (A20805) at dilution of 1:100(40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunoprecipitation - [KO Validated] SIRT3 Rabbit mAb (A20805)}

Immunoprecipitation - [KO Validated] SIRT3 Rabbit mAb (A20805)

Immunoprecipitation analysis of 300ug extracts of Hela cells using 3ug SIRT3 Rabbit mAb (A20805). Western blot was performed from the immunoprecipitate using SIRT3 Rabbit mAb (A20805) at a dilition of 1:1000.

Inquire About This Product

Submit your question about A20805 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on SIRT3. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to SIRT3. (Distance between topics and target gene indicate popularity.) SIRT3

* Data provided by citexs.com, for reference only.

Publishing research using A20805? Please let us know so that we can cite the reference in this datasheet.

Antibodies (5)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order