Product name | [KO Validated] SGTA Rabbit pAb |
---|---|
Catalog No. | A7306 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human SGTA (NP_003012.1). |
---|---|
Sequence | MDNKKRLAYAIIQFLHDQLRHGGLSSDAQESLEVAIQCLETAFGVTVEDSDLALPQTLPEIFEAAATGKEMPQDLRSPARTPPSEEDSAEAERLKTEGNEQMKVENFEAAVHFYGKAIEL |
Gene ID | 6449 |
Swiss prot | O43765 |
Synonyms | SGTA; SGT; alphaSGT; hSGT |
Calculated MW | 34kDa |
Observed MW | 38kDa |
Reactivity | Human |
---|---|
Tested applications | WBIHCICCIFIPChIPChIPseqRIPFCELISAMeDIPNucleotide ArrayDB |
Recommended dilution | WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:100 |
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Application key | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | HeLa, A-549, U-251MG |
Cellular location |
Submit your question about A7306 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.