Product name | [KO Validated] SELENBP1 Rabbit pAb |
---|---|
Catalog No. | A1222 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 243-472 of human SELENBP1 (NP_003935.2). |
---|---|
Sequence | SLKDGLIPLEIRFLHNPDAAQGFVGCALSSTIQRFYKNEGGTWSVEKVIQVPPKKVKGWLLPEMPGLITDILLSLDDRFLYFSNWLHGDLRQYDISDPQRPRLTGQLFLGGSIVKGGPVQVLEDEELKSQPEPLVVKGKRVAGGPQMIQLSLDGKRLYITTSLYSAWDKQFYPDLIREGSVMLQVDVDTVKGGLKLNPNFLVDFGKEPLGPALAHELRYPGGDCSSDIWI |
Gene ID | 8991 |
Swiss prot | Q13228 |
Synonyms | SELENBP1; HEL-S-134P; LPSB; SBP56; SP56; hSBP |
Calculated MW | 45kDa/52kDa/56kDa |
Observed MW | 55kDa |
Reactivity | Human, Mouse |
---|---|
Tested applications | WBIHCICCIFIPChIPChIPseqRIPFCELISAMeDIPNucleotide ArrayDB |
Recommended dilution | WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200 |
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Application key | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | MCF7, Mouse liver, Mouse kideny |
Cellular location | Cytoplasm, Membrane, Nucleus, Peripheral membrane protein, cytosol |
Customer validation | (Human cells) |
Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com
Submit your question about A1222 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.