Product name | [KO Validated] S100A6 Rabbit pAb |
---|---|
Catalog No. | A4104 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human S100A6 (NP_055439.1). |
---|---|
Sequence | MACPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNEALKG |
Gene ID | 6277 |
Swiss prot | P06703 |
Synonyms | S100A6; 2A9; 5B10; CABP; CACY; PRA |
Calculated MW | 10kDa |
Observed MW | 10KDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHCICCIFIPChIPChIPseqRIPFCELISAMeDIPNucleotide ArrayDB |
Recommended dilution | WB 1:200 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200 IP 1:20 - 1:50 |
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Application key | Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation |
Positive samples | HeLa, Mouse lung, Rat lung |
Cellular location | Cell membrane, Cytoplasm, Cytoplasmic side, Nucleus envelope, Peripheral membrane protein |
Submit your question about A4104 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.