Product name | [KO Validated] S100A11 Rabbit pAb |
---|---|
Catalog No. | A5486 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-105 of human S100A11 (NP_005611.1). |
---|---|
Sequence | MAKISSPTETERCIESLIAVFQKYAGKDGYNYTLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDTNSDGQLDFSEFLNLIGGLAMACHDSFLKAVPSQKRT |
Gene ID | 6282 |
Swiss prot | P31949 |
Synonyms | S100A11; HEL-S-43; MLN70; S100C |
Calculated MW | 11kDa |
Observed MW | 12kDa |
Reactivity | Human |
---|---|
Tested applications | WBIHCICCIFIPChIPChIPseqRIPFCELISAMeDIPNucleotide ArrayDB |
Recommended dilution | WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200 IP 1:50 - 1:200 |
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Application key | Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation |
Positive samples | BxPC-3, BT-474, LOVO, 22Rv1, SKOV3, THP-1 |
Cellular location | Cytoplasm, Nucleus |
Submit your question about A5486 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.