Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

[KO Validated] S100A11 Rabbit pAb (A5486)

KO/KDValidated

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human

ABclonal:Western blot - [KO Validated] S100A11 Rabbit pAb (A5486)

Western blot analysis of various lysates using [KO Validated] S100A11 Rabbit pAb (A5486) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Western blot - [KO Validated] S100A11 Rabbit pAb (A5486)

Western blot analysis of lysates from wild type (WT) and S100A11 knockout (KO) HeLa cells, using [KO Validated] S100A11 Rabbit pAb (A5486) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunofluorescence - [KO Validated] S100A11 Rabbit pAb (A5486)

Immunofluorescence analysis of U2OS cells using [KO Validated] S100A11 Rabbit pAb (A5486). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunoprecipitation - [KO Validated] S100A11 Rabbit pAb (A5486)

Immunoprecipitation analysis of 200 μg extracts of THP-1 cells using 3 μg S100A11 antibody (A5486). Western blot was performed from the immunoprecipitate using S100A11 antibody (A5486) at a dilution of 1:1000.

You may also interested in:

Overview

Product name [KO Validated] S100A11 Rabbit pAb
Catalog No. A5486
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in motility, invasion, and tubulin polymerization. Chromosomal rearrangements and altered expression of this gene have been implicated in tumor metastasis.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-105 of human S100A11 (NP_005611.1).
Sequence MAKISSPTETERCIESLIAVFQKYAGKDGYNYTLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDTNSDGQLDFSEFLNLIGGLAMACHDSFLKAVPSQKRT
Gene ID 6282
Swiss prot P31949
Synonyms MLN70; S100C; HEL-S-43; 11
Calculated MW 12kDa
Observed MW 12kDa

Applications

Reactivity Human
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IF/ICC 1:50 - 1:200
  • IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    Immunoprecipitation    
Positive samples BxPC-3, BT-474, LOVO, 22Rv1, SKOV3, THP-1
Cellular location Cytoplasm, Nucleus

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

[KO Validated] S100A11 Rabbit pAb images

ABclonal:Western blot - [KO Validated] S100A11 Rabbit pAb (A5486)}

Western blot - [KO Validated] S100A11 Rabbit pAb (A5486)

Western blot analysis of various lysates using [KO Validated] S100A11 Rabbit pAb (A5486) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
ABclonal:Western blot - [KO Validated] S100A11 Rabbit pAb (A5486)}

Western blot - [KO Validated] S100A11 Rabbit pAb (A5486)

Western blot analysis of lysates from wild type (WT) and S100A11 knockout (KO) HeLa cells, using [KO Validated] S100A11 Rabbit pAb (A5486) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
ABclonal:Immunofluorescence - [KO Validated] S100A11 Rabbit pAb (A5486)}

Immunofluorescence - [KO Validated] S100A11 Rabbit pAb (A5486)

Immunofluorescence analysis of U2OS cells using [KO Validated] S100A11 Rabbit pAb (A5486). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunoprecipitation - [KO Validated] S100A11 Rabbit pAb (A5486)}

Immunoprecipitation - [KO Validated] S100A11 Rabbit pAb (A5486)

Immunoprecipitation analysis of 200 μg extracts of THP-1 cells using 3 μg S100A11 antibody (A5486). Western blot was performed from the immunoprecipitate using S100A11 antibody (A5486) at a dilution of 1:1000.

Inquire About This Product

Submit your question about A5486 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on S100A11. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to S100A11. (Distance between topics and target gene indicate popularity.) S100A11

* Data provided by citexs.com, for reference only.

Publishing research using A5486? Please let us know so that we can cite the reference in this datasheet.

Antibodies (2)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order