Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

[KO Validated] RhoGDI Rabbit pAb (A1214)

KO/KDValidated

Publications (6) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - [KO Validated] RhoGDI Rabbit pAb (A1214)

Western blot analysis of extracts from normal (control) and RhoGDI knockout (KO) 293T cells, using RhoGDI antibody (A1214) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunofluorescence - [KO Validated] RhoGDI Rabbit pAb (A1214)

Immunofluorescence analysis of HeLa cells using RhoGDI antibody (A1214). Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name [KO Validated] RhoGDI Rabbit pAb
Catalog No. A1214
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a protein that plays a key role in the regulation of signaling through Rho GTPases. The encoded protein inhibits the disassociation of Rho family members from GDP (guanine diphosphate), thereby maintaining these factors in an inactive state. Activity of this protein is important in a variety of cellular processes, and expression of this gene may be altered in tumors. Mutations in this gene have been found in individuals with nephrotic syndrome, type 8. Alternate splicing results in multiple transcript variants.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-204 of human RhoGDI (NP_001172006.1).
Sequence MAEQEPTAEQLAQIAAENEEDEHSVNYKPPAQKSIQEIQELDKDDESLRKYKEALLGRVAVSADPNVPNVVVTGLTLVCSSAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNREIVSGMKYIQHTYRKGVKIDKTDYMVGSYGPRAEEYEFLTPVEEAPKGMLARGSYSIKSRFTDDDKTDHLSWEWNLTIKKDWKD
Gene ID 396
Swiss prot P52565
Synonyms GDIA1; NPHS8; RHOGDI; RHOGDI-1; HEL-S-47e; DI
Calculated MW 23kDa
Observed MW 25kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples 293T, HeLa, COS7, PC-12, Mouse lung, Mouse spleen, Mouse kidney
Cellular location Cytoplasm
Customer validation

WB (Homo sapiens, Mus musculus, Rattus norvegicus)

Co-IP (Rattus norvegicus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

[KO Validated] RhoGDI Rabbit pAb images

ABclonal:Western blot - [KO Validated] RhoGDI Rabbit pAb (A1214)}

Western blot - [KO Validated] RhoGDI Rabbit pAb (A1214)

Western blot analysis of extracts from normal (control) and RhoGDI knockout (KO) 293T cells, using RhoGDI antibody (A1214) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
ABclonal:Immunofluorescence - [KO Validated] RhoGDI Rabbit pAb (A1214)}

Immunofluorescence - [KO Validated] RhoGDI Rabbit pAb (A1214)

Immunofluorescence analysis of HeLa cells using RhoGDI antibody (A1214). Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A1214 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on ARHGDIA. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to ARHGDIA. (Distance between topics and target gene indicate popularity.) ARHGDIA

* Data provided by citexs.com, for reference only.

Publishing research using A1214? Please let us know so that we can cite the reference in this datasheet.

Antibodies (2)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order