Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

[KO Validated] RhoC Rabbit pAb (A1062)

KO/KDValidated

Publications (2) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Rat

ABclonal:Western blot - [KO Validated] RhoC Rabbit pAb (A1062)

Western blot analysis of extracts from normal (control) and RhoC knockout (KO) 293T cells, using RhoC antibody (A1062) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 300s.

ABclonal:Western blot - [KO Validated] RhoC Rabbit pAb (A1062)

Western blot analysis of extracts of Rat heart cells, using RhoC antibody (A1062) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

You may also interested in:

Overview

Product name [KO Validated] RhoC Rabbit pAb
Catalog No. A1062
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a member of the Rho family of small GTPases, which cycle between inactive GDP-bound and active GTP-bound states and function as molecular switches in signal transduction cascades. Rho proteins promote reorganization of the actin cytoskeleton and regulate cell shape, attachment, and motility. The protein encoded by this gene is prenylated at its C-terminus, and localizes to the cytoplasm and plasma membrane. It is thought to be important in cell locomotion. Overexpression of this gene is associated with tumor cell proliferation and metastasis. Multiple alternatively spliced variants, encoding the same protein, have been identified.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-193 of human RhoC (NP_786886.1).
Sequence MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVRSEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAGLQVRKNKRRRGCPIL
Gene ID 389
Swiss prot P08134
Synonyms H9; ARH9; ARHC; RHOH9; oC
Calculated MW 22kDa
Observed MW 22kDa

Applications

Reactivity Human, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples 293T, Rat heart
Cellular location Cell membrane, Cleavage furrow, Cytoplasmic side, Lipid-anchor
Customer validation

WB (Homo sapiens, Mus musculus)

IF (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

[KO Validated] RhoC Rabbit pAb images

ABclonal:Western blot - [KO Validated] RhoC Rabbit pAb (A1062)}

Western blot - [KO Validated] RhoC Rabbit pAb (A1062)

Western blot analysis of extracts from normal (control) and RhoC knockout (KO) 293T cells, using RhoC antibody (A1062) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 300s.
ABclonal:Western blot - [KO Validated] RhoC Rabbit pAb (A1062)}

Western blot - [KO Validated] RhoC Rabbit pAb (A1062)

Western blot analysis of extracts of Rat heart cells, using RhoC antibody (A1062) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Inquire About This Product

Submit your question about A1062 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on RHOC. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to RHOC. (Distance between topics and target gene indicate popularity.) RHOC

* Data provided by citexs.com, for reference only.

Publishing research using A1062? Please let us know so that we can cite the reference in this datasheet.

Antibodies (1)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order