Product name | [KO Validated] RHOC Rabbit pAb |
---|---|
Catalog No. | A1062 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-193 of human RHOC (NP_001036144.1). |
---|---|
Sequence | MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVRSEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAGLQVRKNKRRRGCPIL |
Gene ID | 389 |
Swiss prot | P08134 |
Synonyms | RHOC; ARH9; ARHC; H9; RHOH9 |
Calculated MW | 22kDa |
Observed MW | 22kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHCICCIFIPChIPChIPseqRIPFCELISAMeDIPNucleotide ArrayDB |
Recommended dilution | WB 1:500 - 1:2000 IHC 1:50 - 1:100 IF 1:50 - 1:100 |
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Application key | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | U2OS, Jurkat, A-549, PC-12 |
Cellular location | Cell membrane, Cleavage furrow, Cytoplasmic side, Lipid-anchor |
Customer validation | WB(Homo sapiens,Mus musculus) |
Submit your question about A1062 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Publishing research using A1062? Please let us know so that we can cite the reference in this datasheet.