Product name | [KO Validated] RAB27A Rabbit pAb |
---|---|
Catalog No. | A1934 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-221 of human RAB27A (NP_899057.1). |
---|---|
Sequence | MSDGDYDYLIKFLALGDSGVGKTSVLYQYTDGKFNSKFITTVGIDFREKRVVYRASGPDGATGRGQRIHLQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYCENPDIVLCGNKSDLEDQRVVKEEEAIALAEKYGIPYFETSAANGTNISQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHASTDQLSEEKEKGACGC |
Gene ID | 5873 |
Swiss prot | P51159 |
Synonyms | RAB27A; GS2; HsT18676; RAB27; RAM |
Calculated MW | 24kDa |
Observed MW | 25kDa |
Reactivity | Human, Mouse |
---|---|
Tested applications | WBIHCICCIFIPChIPChIPseqRIPFCELISAMeDIPNucleotide ArrayDB |
Recommended dilution | WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:10 - 1:100 |
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Application key | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | U-937 |
Cellular location | Late endosome, Lipid-anchor, Lysosome, Melanosome, Membrane |
Customer validation | WB(Homo sapiens,Mus musculus) IF(Homo sapiens,Mus musculus) |
Submit your question about A1934 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Publishing research using A1934? Please let us know so that we can cite the reference in this datasheet.