Reviews (2)Publications (2) Datasheet
Product name | [KO Validated] PTPN1 Rabbit pAb |
---|---|
Catalog No. | A1590 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 281-435 of human PTPN1 (NP_002818.1). |
---|---|
Sequence | IMGDSSVQDQWKELSHEDLEPPPEHIPPPPRPPKRILEPHNGKCREFFPNHQWVKEETQEDKDCPIKEEKGSPLNAAPYGIESMSQDTEVRSRVVGGSLRGAQAASPAKGEPSLPEKDEDHALSYWKPFLVNMCVATVLTAGAYLCYRFLFNSNT |
Gene ID | 5770 |
Swiss prot | P18031 |
Synonyms | PTPN1; PTP1B |
Calculated MW | 49kDa |
Observed MW | 50kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHCICCIFIPChIPChIPseqRIPFCELISAMeDIPNucleotide ArrayDB |
Recommended dilution | WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:10 - 1:100 |
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Application key | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | BT-474, SKOV3, U-251MG, Mouse brain, Rat brain |
Cellular location | Cytoplasmic side, Endoplasmic reticulum membrane, Peripheral membrane protein |
Customer validation | (Mouse liver, A549) WB(Mus musculus, Homo sapiens) |
Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com
Submit your question about A1590 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Publishing research using A1590? Please let us know so that we can cite the reference in this datasheet.