Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

PTPN1 Rabbit pAb (A1590)

Reviews (2) Publications (7) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - PTPN1 Rabbit pAb (A1590)

Western blot analysis of extracts of various cell lines, using PTPN1 antibody (A1590) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunofluorescence - PTPN1 Rabbit pAb (A1590)

Immunofluorescence analysis of U2OS cells using PTPN1 Rabbit pAb (A1590) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Review
ABclonal: review for PTPN1 Rabbit pAb(A1590)
Review
ABclonal: review for PTPN1 Rabbit pAb(A1590)

You may also interested in:

Overview

Product name PTPN1 Rabbit pAb
Catalog No. A1590
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The protein encoded by this gene is the founding member of the protein tyrosine phosphatase (PTP) family, which was isolated and identified based on its enzymatic activity and amino acid sequence. PTPs catalyze the hydrolysis of the phosphate monoesters specifically on tyrosine residues. Members of the PTP family share a highly conserved catalytic motif, which is essential for the catalytic activity. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP has been shown to act as a negative regulator of insulin signaling by dephosphorylating the phosphotryosine residues of insulin receptor kinase. This PTP was also reported to dephosphorylate epidermal growth factor receptor kinase, as well as JAK2 and TYK2 kinases, which implicated the role of this PTP in cell growth control, and cell response to interferon stimulation. Two transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 281-435 of human PTPN1 (NP_002818.1).
Sequence IMGDSSVQDQWKELSHEDLEPPPEHIPPPPRPPKRILEPHNGKCREFFPNHQWVKEETQEDKDCPIKEEKGSPLNAAPYGIESMSQDTEVRSRVVGGSLRGAQAASPAKGEPSLPEKDEDHALSYWKPFLVNMCVATVLTAGAYLCYRFLFNSNT
Gene ID 5770
Swiss prot P18031
Synonyms PTP1B; PTPN1
Calculated MW 50kDa
Observed MW 50kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples BT-474, SKOV3, U-251MG, Mouse brain, Rat brain
Cellular location Cytoplasmic side, Endoplasmic reticulum membrane, Peripheral membrane protein
Customer validation

WB (Mouse liver, A549Mus musculus, Homo sapiens, Mus musculus)

IF (Mus musculus)

IHC (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

PTPN1 Rabbit pAb images

ABclonal:Western blot - PTPN1 Rabbit pAb (A1590)}

Western blot - PTPN1 Rabbit pAb (A1590)

Western blot analysis of extracts of various cell lines, using PTPN1 antibody (A1590) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
ABclonal:Immunofluorescence - PTPN1 Rabbit pAb (A1590)}

Immunofluorescence - PTPN1 Rabbit pAb (A1590)

Immunofluorescence analysis of U2OS cells using PTPN1 Rabbit pAb (A1590) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Submit an review for A1590

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A1590 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on PTPN1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to PTPN1. (Distance between topics and target gene indicate popularity.) PTPN1

* Data provided by citexs.com, for reference only.

Publishing research using A1590? Please let us know so that we can cite the reference in this datasheet.

ELISA Kits (1)

Antibodies (2)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order