Product name | [KO Validated] PRDX4 Rabbit pAb |
---|---|
Catalog No. | A1486 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 38-271 of human PRDX4 (NP_006397.1). |
---|---|
Sequence | WETEERPRTREEECHFYAGGQVYPGEASRVSVADHSLHLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRLEEFRSINTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDLTHQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSETIIPDPAGKLKYFDKLN |
Gene ID | 10549 |
Swiss prot | Q13162 |
Synonyms | PRDX4; AOE37-2; AOE372; HEL-S-97n; PRX-4 |
Calculated MW | 30kDa |
Observed MW | 28kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHCICCIFIPChIPChIPseqRIPFCELISAMeDIPNucleotide ArrayDB |
Recommended dilution | WB 1:500 - 1:2000 IF 1:50 - 1:100 |
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Application key | Western blotting Immunofluorescence |
Positive samples | H460, PC-3, HeLa, MCF-7, Mouse testis |
Cellular location | Cytoplasm, Secreted |
Submit your question about A1486 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.