Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

[KO Validated] PEPCK/PCK2 Rabbit mAb (A4466)

KO/KDValidated

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - [KO Validated] PEPCK/PCK2 Rabbit mAb (A4466)

Western blot analysis of various lysates using PEPCK/PEPCK/PCK2 Rabbit mAb (A4466) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Western blot - [KO Validated] PEPCK/PCK2 Rabbit mAb (A4466)

Western blot analysis of lysates from wild type(WT) and PEPCK/PCK2 knockout (KO) 293T cells, using [KO Validated] PEPCK/PCK2 Rabbit mAb (A4466) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunofluorescence - [KO Validated] PEPCK/PCK2 Rabbit mAb (A4466)

Confocal imaging of HeLa cells using [KO Validated] PEPCK/PCK2 Rabbit mAb (A4466, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo® 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.

ABclonal:Immunofluorescence - [KO Validated] PEPCK/PCK2 Rabbit mAb (A4466)

Confocal imaging of C2C12 cells using [KO Validated] PEPCK/PCK2 Rabbit mAb (A4466, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo® 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.

You may also interested in:

Overview

Product name [KO Validated] PEPCK/PCK2 Rabbit mAb
Catalog No. A4466
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC1017

Background

This gene encodes a mitochondrial enzyme that catalyzes the conversion of oxaloacetate to phosphoenolpyruvate in the presence of guanosine triphosphate (GTP). A cytosolic form of this protein is encoded by a different gene and is the key enzyme of gluconeogenesis in the liver. Alternatively spliced transcript variants have been described.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 550-640 of human PEPCK/PEPCK/PCK2 (Q16822).
Sequence ENARVLDWICRRLEGEDSARETPIGLVPKEGALDLSGLRAIDTTQLFSLPKDFWEQEVRDIRSYLTEQVNQDLPKEVLAELEALERRVHKM
Gene ID 5106
Swiss prot Q16822
Synonyms PEPCK; PEPCK2; PEPCK-M; K2
Calculated MW 71kDa
Observed MW 71kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications Testing results
WB HumanMouseRat
IF/ICC Human
Recommended dilution
  • WB 1:500 - 1:1000
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples HeLa, 293T, Hep G2, Mouse lung, Mouse brain, Mouse spleen, Rat kidney
Cellular location Mitochondrion

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

[KO Validated] PEPCK/PCK2 Rabbit mAb images

ABclonal:Western blot - [KO Validated] PEPCK/PCK2 Rabbit mAb (A4466)}

Western blot - [KO Validated] PEPCK/PCK2 Rabbit mAb (A4466)

Western blot analysis of various lysates using PEPCK/PEPCK/PCK2 Rabbit mAb (A4466) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
ABclonal:Western blot - [KO Validated] PEPCK/PCK2 Rabbit mAb (A4466)}

Western blot - [KO Validated] PEPCK/PCK2 Rabbit mAb (A4466)

Western blot analysis of lysates from wild type(WT) and PEPCK/PCK2 knockout (KO) 293T cells, using [KO Validated] PEPCK/PCK2 Rabbit mAb (A4466) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
ABclonal:Immunofluorescence - [KO Validated] PEPCK/PCK2 Rabbit mAb (A4466)}

Immunofluorescence - [KO Validated] PEPCK/PCK2 Rabbit mAb (A4466)

Confocal imaging of HeLa cells using [KO Validated] PEPCK/PCK2 Rabbit mAb (A4466, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo® 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.
ABclonal:Immunofluorescence - [KO Validated] PEPCK/PCK2 Rabbit mAb (A4466)}

Immunofluorescence - [KO Validated] PEPCK/PCK2 Rabbit mAb (A4466)

Confocal imaging of C2C12 cells using [KO Validated] PEPCK/PCK2 Rabbit mAb (A4466, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo® 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.

Inquire About This Product

Submit your question about A4466 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on PCK2. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to PCK2. (Distance between topics and target gene indicate popularity.) PCK2

* Data provided by citexs.com, for reference only.

Publishing research using A4466? Please let us know so that we can cite the reference in this datasheet.

Antibodies (2)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order