Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

[KO Validated] PDCD10 Rabbit pAb (A15400)

KO/KDValidated

Datasheet

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - [KO Validated] PDCD10 Rabbit pAb (A15400)

Western blot analysis of lysates from wild type (WT) and PDCD10 knockout (KO) HeLa cells, using [KO Validated] PDCD10 Rabbit pAb (A15400) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 15s.

You may also interested in:

Overview

Product name [KO Validated] PDCD10 Rabbit pAb
Catalog No. A15400
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes an evolutionarily conserved protein associated with cell apoptosis. The protein interacts with the serine/threonine protein kinase MST4 to modulate the extracellular signal-regulated kinase (ERK) pathway. It also interacts with and is phosphoryated by serine/threonine kinase 25, and is thought to function in a signaling pathway essential for vascular developent. Mutations in this gene are one cause of cerebral cavernous malformations, which are vascular malformations that cause seizures and cerebral hemorrhages. Multiple alternatively spliced variants, encoding the same protein, have been identified.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-212 of human PDCD10 (NP_009148.2).
Sequence MRMTMEEMKNEAETTSMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKKSVEVNFTESLLRMAADDVEEYMIERPEPEFQDLNEKARALKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKKYQYQNRRALEHQKKEFVKYSKSFSDTLKTYFKDGKAINVFVSANRLIHQTNLILQTFKTVA
Gene ID 11235
Swiss prot Q9BUL8
Synonyms CCM3; TFAR15; 10
Calculated MW 25kDa
Observed MW 26kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:200 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples A-431, K-562, U-251MG, SKOV3, Mouse brain, Mouse kidney, Rat brain
Cellular location Cell membrane, Cytoplasm, Cytoplasmic side, Golgi apparatus membrane, Peripheral membrane protein

[KO Validated] PDCD10 Rabbit pAb images

ABclonal:Western blot - [KO Validated] PDCD10 Rabbit pAb (A15400)}

Western blot - [KO Validated] PDCD10 Rabbit pAb (A15400)

Western blot analysis of lysates from wild type (WT) and PDCD10 knockout (KO) HeLa cells, using [KO Validated] PDCD10 Rabbit pAb (A15400) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 15s.

Inquire About This Product

Submit your question about A15400 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on PDCD10. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to PDCD10. (Distance between topics and target gene indicate popularity.) PDCD10

* Data provided by citexs.com, for reference only.

Publishing research using A15400? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order