Product name | [KO Validated] OXCT1 Rabbit pAb |
---|---|
Catalog No. | A8139 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 261-520 of human OXCT1 (NP_000427.1). |
---|---|
Sequence | IPQIYVHRLIKGEKYEKRIERLSIRKEGDGEAKSAKPGDDVRERIIKRAALEFEDGMYANLGIGIPLLASNFISPNITVHLQSENGVLGLGPYPRQHEADADLINAGKETVTILPGASFFSSDESFAMIRGGHVDLTMLGAMQVSKYGDLANWMIPGKMVKGMGGAMDLVSSAKTKVVVTMEHSAKGNAHKIMEKCTLPLTGKQCVNRIITEKAVFDVDKKKGLTLIELWEGLTVDDVQKSTGCDFAVSPKLMPMQQIAN |
Gene ID | 5019 |
Swiss prot | P55809 |
Synonyms | OXCT1; OXCT; SCOT |
Calculated MW | 13kDa/56kDa |
Observed MW | 56kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHCICCIFIPChIPChIPseqRIPFCELISAMeDIPNucleotide ArrayDB |
Recommended dilution | WB 1:500 - 1:2000 IHC 1:50 - 1:100 |
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Application key | Western blotting Immunohistochemistry |
Positive samples | BT-474, HeLa, Jurkat, 293T, Mouse kidney, Mouse heart, Rat kidney |
Cellular location | Mitochondrion matrix |
Submit your question about A8139 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.