Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

NF-kB p65/RelA Rabbit mAb (A19653)

Review (1) Publications (56) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat, Monkey

ABclonal:Western blot - NF-kB p65/RelA Rabbit mAb (A19653)

Western blot analysis of various lysates, using NF-kB p65/RelA Rabbit mAb (A19653) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunohistochemistry - NF-kB p65/RelA Rabbit mAb (A19653)

Immunohistochemistry analysis of NF-kB p65/RelA in paraffin-embedded human thyroid cancer tissue using NF-kB p65/RelA Rabbit mAb (A19653) at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunohistochemistry - NF-kB p65/RelA Rabbit mAb (A19653)

Immunohistochemistry analysis of NF-kB p65/RelA in paraffin-embedded human tonsil tissue using NF-kB p65/RelA Rabbit mAb (A19653) at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunohistochemistry - NF-kB p65/RelA Rabbit mAb (A19653)

Immunohistochemistry analysis of NF-kB p65/RelA in paraffin-embedded mouse spleen tissue using NF-kB p65/RelA Rabbit mAb (A19653) at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunohistochemistry - NF-kB p65/RelA Rabbit mAb (A19653)

Immunohistochemistry analysis of NF-kB p65/RelA in paraffin-embedded rat spleen tissue using NF-kB p65/RelA Rabbit mAb (A19653) at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunofluorescence - NF-kB p65/RelA Rabbit mAb (A19653)

Immunofluorescence analysis of NIH/3T3 cells using NF-kB p65/RelA Rabbit mAb (A19653) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - NF-kB p65/RelA Rabbit mAb (A19653)

Immunofluorescence analysis of U-2 OS cells using NF-kB p65/RelA Rabbit mAb (A19653) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Chromatin Immunoprecipitation - NF-kB p65/RelA Rabbit mAb (A19653)

Chromatin immunoprecipitation analysis of extracts of HT-1080 treated by TNF-α (20 ng/ml) at 37℃ for 30 minutes, using NF-kB p65/RelA Rabbit mAb antibody (A19653) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.

Review
ABclonal: review for NF-kB p65/RelA Rabbit mAb(A19653)

You may also interested in:

Overview

Product name NF-kB p65/RelA Rabbit mAb
Catalog No. A19653
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC51086

Background

NF-kappa-B is a ubiquitous transcription factor involved in several biological processes. It is held in the cytoplasm in an inactive state by specific inhibitors. Upon degradation of the inhibitor, NF-kappa-B moves to the nucleus and activates transcription of specific genes. NF-kappa-B is composed of NFKB1 or NFKB2 bound to either REL, RELA, or RELB. The most abundant form of NF-kappa-B is NFKB1 complexed with the product of this gene, RELA. Four transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 450-551 of human NF-κB p65 (Q04206).
Sequence LGALLGNSTDPAVFTDLASVDNSEFQQLLNQGIPVAPHTTEPMLMEYPEAITRLVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADMDFSALLSQISS
Gene ID 5970
Swiss prot Q04206
Synonyms p65; CMCU; NFKB3; AIF3BL3; NF-kB p65/RelA
Calculated MW 60kDa
Observed MW 65kDa

Applications

Reactivity Human, Mouse, Rat, Monkey
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:500 - 1:1000
  • IF/ICC 1:50 - 1:200
  • ChIP 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples PC-12, Mouse spleen, Mouse lung
Cellular location Cytoplasm, Nucleus
Customer validation

(RPMI-8226、PC-3、HepG2、Hela、U2-OS、Jurkat、MOLT-4)

WB (Mus musculus, Homo sapiens, Rattus norvegicus)

IF (Homo sapiens)

IHC (Rattus norvegicus, A. baumannii)

WB (Homo sapiens)

IF (Rattus norvegicus, Mus musculus , Mus musculus)

WB,IF (Rattus norvegicus, Mus musculus)

IP (Mus musculus )

(Rattus norvegicus)

IHC (Mus musculus)

IF/ICC (Homo sapiens)

FC (Homo sapiens )

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

NF-kB p65/RelA Rabbit mAb images

ABclonal:Western blot - NF-kB p65/RelA Rabbit mAb (A19653)}

Western blot - NF-kB p65/RelA Rabbit mAb (A19653)

Western blot analysis of various lysates, using NF-kB p65/RelA Rabbit mAb (A19653) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
ABclonal:Immunohistochemistry - NF-kB p65/RelA Rabbit mAb (A19653)}

Immunohistochemistry - NF-kB p65/RelA Rabbit mAb (A19653)

Immunohistochemistry analysis of NF-kB p65/RelA in paraffin-embedded human thyroid cancer tissue using NF-kB p65/RelA Rabbit mAb (A19653) at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunohistochemistry - NF-kB p65/RelA Rabbit mAb (A19653)}

Immunohistochemistry - NF-kB p65/RelA Rabbit mAb (A19653)

Immunohistochemistry analysis of NF-kB p65/RelA in paraffin-embedded human tonsil tissue using NF-kB p65/RelA Rabbit mAb (A19653) at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunohistochemistry - NF-kB p65/RelA Rabbit mAb (A19653)}

Immunohistochemistry - NF-kB p65/RelA Rabbit mAb (A19653)

Immunohistochemistry analysis of NF-kB p65/RelA in paraffin-embedded mouse spleen tissue using NF-kB p65/RelA Rabbit mAb (A19653) at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunohistochemistry - NF-kB p65/RelA Rabbit mAb (A19653)}

Immunohistochemistry - NF-kB p65/RelA Rabbit mAb (A19653)

Immunohistochemistry analysis of NF-kB p65/RelA in paraffin-embedded rat spleen tissue using NF-kB p65/RelA Rabbit mAb (A19653) at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunofluorescence - NF-kB p65/RelA Rabbit mAb (A19653)}

Immunofluorescence - NF-kB p65/RelA Rabbit mAb (A19653)

Immunofluorescence analysis of NIH/3T3 cells using NF-kB p65/RelA Rabbit mAb (A19653) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - NF-kB p65/RelA Rabbit mAb (A19653)}

Immunofluorescence - NF-kB p65/RelA Rabbit mAb (A19653)

Immunofluorescence analysis of U-2 OS cells using NF-kB p65/RelA Rabbit mAb (A19653) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Chromatin Immunoprecipitation - NF-kB p65/RelA Rabbit mAb (A19653)}

Chromatin Immunoprecipitation - NF-kB p65/RelA Rabbit mAb (A19653)

Chromatin immunoprecipitation analysis of extracts of HT-1080 treated by TNF-α (20 ng/ml) at 37℃ for 30 minutes, using NF-kB p65/RelA Rabbit mAb antibody (A19653) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.

Submit an review for A19653

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A19653 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on RELA. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to RELA. (Distance between topics and target gene indicate popularity.) RELA

* Data provided by citexs.com, for reference only.

Publishing research using A19653? Please let us know so that we can cite the reference in this datasheet.

Antibodies (19)

ELISA Kits (1)

Proteins (1)

Secondary Antibodies (22)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order