Product name | [KO Validated] NDUFC2 Rabbit pAb |
---|---|
Catalog No. | A15073 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human NDUFC2 (NP_004540.1). |
---|---|
Sequence | MIARRNPEPLRFLPDEARSLPPPKLTDPRLLYIGFLGYCSGLIDNLIRRRPIATAGLHRQLLYITAFFFAGYYLVKREDYLYAVRDREMFGYMKLHPEDF |
Gene ID | 4718 |
Swiss prot | O95298 |
Synonyms | NDUFC2; B14.5b; CI-B14.5b; HLC-1; NADHDH2 |
Calculated MW | 10kDa/11kDa/13kDa/14kDa |
Observed MW | 14kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHCICCIFIPChIPChIPseqRIPFCELISAMeDIPNucleotide ArrayDB |
Recommended dilution | WB 1:500 - 1:2000 IHC 1:100 - 1:200 |
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Application key | Western blotting Immunohistochemistry |
Positive samples | 293T, OVCAR3, HeLa, A-549, mouse stomach, mouse brain, mouse heart, rat kidney |
Cellular location | Matrix side, Mitochondrion inner membrane, Single-pass membrane protein |
Submit your question about A15073 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.