Product name | [KO Validated] NCOA4 Rabbit pAb |
---|---|
Catalog No. | A5695 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 495-614 of human NCOA4 (NP_005428.1). |
---|---|
Sequence | SEWLIRPPYKEGSPKEVPGTEDRAGKQKFKSPMNTSWCSFNTADWVLPGKKMGNLSQLSSGEDKWLLRKKAQEVLLNSPLQEEHNFPPDHYGLPAVCDLFACMQLKVDKEKWLYRTPLQM |
Gene ID | 8031 |
Swiss prot | Q13772 |
Synonyms | NCOA4; ARA70; ELE1; PTC3; RFG |
Calculated MW | 32kDa/69kDa/71kDa/73kDa |
Observed MW | 70kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHCICCIFIPChIPChIPseqRIPFCELISAMeDIPNucleotide ArrayDB |
Recommended dilution | WB 1:500 - 1:2000 IHC 1:50 - 1:100 IF 1:50 - 1:200 |
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Application key | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | A375, HeLa, MCF7, 293T, Mouse testis, Rat testis |
Cellular location | |
Customer validation | WB(Homo sapiens) IF(Homo sapiens) |
Submit your question about A5695 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Publishing research using A5695? Please let us know so that we can cite the reference in this datasheet.