Review (1)Publications (3) Datasheet
Product name | [KO Validated] NBN Rabbit pAb |
---|---|
Catalog No. | A0783 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 435-754 of human NBN (NP_002476.2). |
---|---|
Sequence | KLPSINKSKDRASQQQQTNSIRNYFQPSTKKRERDEENQEMSSCKSARIETSCSLLEQTQPATPSLWKNKEQHLSENEPVDTNSDNNLFTDTDLKSIVKNSASKSHAAEKLRSNKKREMDDVAIEDEVLEQLFKDTKPELEIDVKVQKQEEDVNVRKRPRMDIETNDTFSDEAVPESSKISQENEIGKKRELKEDSLWSAKEISNNDKLQDDSEMLPKKLLLTEFRSLVIKNSTSRNPSGINDDYGQLKNFKKFKKVTYPGAGKLPHIIGGSDLIAHHARKNTELEEWLRQEMEVQNQHAKEESLADDLFRYNPYLKRRR |
Gene ID | 4683 |
Swiss prot | O60934 |
Synonyms | NBN; AT-V1; AT-V2; ATV; NBS; NBS1; P95; nibrin |
Calculated MW | 84kDa |
Observed MW | 95kDa/70kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHCICCIFIPChIPChIPseqRIPFCELISAMeDIPNucleotide ArrayDB |
Recommended dilution | WB 1:500 - 1:1000 IHC 1:50 - 1:100 |
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Application key | Western blotting Immunohistochemistry |
Positive samples | 293T, Mouse testis, Rat testis |
Cellular location | Chromosome, Nucleus, PML body, telomere |
Customer validation | (Mouse adipose-derived stem cells) WB(Homo sapiens) |
Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com
Submit your question about A0783 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Publishing research using A0783? Please let us know so that we can cite the reference in this datasheet.