Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

MMP2 Rabbit mAb (A19080)

Publications (18) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - MMP2 Rabbit mAb (A19080)

Western blot analysis of extracts of various cell lines, using MMP2 antibody (A19080) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

You may also interested in:

Overview

Product name MMP2 Rabbit mAb
Catalog No. A19080
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC0432

Background

This gene is a member of the matrix metalloproteinase (MMP) gene family, that are zinc-dependent enzymes capable of cleaving components of the extracellular matrix and molecules involved in signal transduction. The protein encoded by this gene is a gelatinase A, type IV collagenase, that contains three fibronectin type II repeats in its catalytic site that allow binding of denatured type IV and V collagen and elastin. Unlike most MMP family members, activation of this protein can occur on the cell membrane. This enzyme can be activated extracellularly by proteases, or, intracellulary by its S-glutathiolation with no requirement for proteolytical removal of the pro-domain. This protein is thought to be involved in multiple pathways including roles in the nervous system, endometrial menstrual breakdown, regulation of vascularization, and metastasis. Mutations in this gene have been associated with Winchester syndrome and Nodulosis-Arthropathy-Osteolysis (NAO) syndrome. Alternative splicing results in multiple transcript variants encoding different isoforms.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 500-600 of human MMP2 (P08253).
Sequence RDKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEYWIYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDP
Gene ID 4313
Swiss prot P08253
Synonyms CLG4; MONA; CLG4A; MMP-2; TBE-1; MMP-II; MMP2
Calculated MW 74kDa
Observed MW 70kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications Testing results
WB MouseRat
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples HCT116, U-87MG, Mouse lung, Rat lung
Cellular location Cytoplasm, Membrane, Mitochondrion, Nucleus, Secreted, extracellular matrix, extracellular space
Customer validation

WB (Homo sapiens, Sanghuangporus vaninii, Mus musculus)

IHC (Homo sapiens)

IF (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

MMP2 Rabbit mAb images

ABclonal:Western blot - MMP2 Rabbit mAb (A19080)}

Western blot - MMP2 Rabbit mAb (A19080)

Western blot analysis of extracts of various cell lines, using MMP2 antibody (A19080) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Inquire About This Product

Submit your question about A19080 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on MMP2. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to MMP2. (Distance between topics and target gene indicate popularity.) MMP2

* Data provided by citexs.com, for reference only.

Publishing research using A19080? Please let us know so that we can cite the reference in this datasheet.

Antibodies (4)

Proteins (2)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order