Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

[KO Validated] MMP13 Rabbit pAb (A11755)

KO/KDValidated

Publications (16) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - [KO Validated] MMP13 Rabbit pAb (A11755)

Western blot analysis of extracts of various cell lines, using MMP13 Rabbit pAb (A11755) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.

ABclonal:Western blot - [KO Validated] MMP13 Rabbit pAb (A11755)

Western blot analysis of various lysates, using MMP13 antibody (A11755) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Western blot - [KO Validated] MMP13 Rabbit pAb (A11755)

Western blot analysis of extracts from wild type(WT) and MMP13 knockdown (KD) 293T(KD) cells, using MMP13 antibody (A11755) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunofluorescence - [KO Validated] MMP13 Rabbit pAb (A11755)

Immunofluorescence analysis of C6 cells using MMP13 Rabbit pAb (A11755) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - [KO Validated] MMP13 Rabbit pAb (A11755)

Immunofluorescence analysis of L929 cells using MMP13 Rabbit pAb (A11755) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - [KO Validated] MMP13 Rabbit pAb (A11755)

Immunofluorescence analysis of U2OS cells using MMP13 Rabbit pAb (A11755) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name [KO Validated] MMP13 Rabbit pAb
Catalog No. A11755
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a member of the peptidase M10 family of matrix metalloproteinases (MMPs). Proteins in this family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. The encoded preproprotein is proteolytically processed to generate the mature protease. This protease cleaves type II collagen more efficiently than types I and III. It may be involved in articular cartilage turnover and cartilage pathophysiology associated with osteoarthritis. Mutations in this gene are associated with metaphyseal anadysplasia. This gene is part of a cluster of MMP genes on chromosome 11.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 262-471 of human MMP13 (NP_002418.1).
Sequence IQSLYGPGDEDPNPKHPKTPDKCDPSLSLDAITSLRGETMIFKDRFFWRLHPQQVDAELFLTKSFWPELPNRIDAAYEHPSHDLIFIFRGRKFWALNGYDILEGYPKKISELGLPKEVKKISAAVHFEDTGKTLLFSGNQVWRYDDTNHIMDKDYPRLIEEDFPGIGDKVDAVYEKNGYIYFFNGPIQFEYSIWSNRIVRVMPANSILWC
Gene ID 4322
Swiss prot P45452
Synonyms CLG3; MDST; MANDP1; MMP-13; 13
Calculated MW 54kDa
Observed MW 65-70kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:1000 - 1:5000
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples 293T, PC-3, Mouse kidney
Cellular location Secreted, extracellular matrix, extracellular space
Customer validation

IHC (Homo sapiens, Mus musculus)

WB (Rattus norvegicus, Mus musculus, Homo sapiens)

IF (Homo sapiens)

ELISA (Rattus norvegicus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

[KO Validated] MMP13 Rabbit pAb images

ABclonal:Western blot - [KO Validated] MMP13 Rabbit pAb (A11755)}

Western blot - [KO Validated] MMP13 Rabbit pAb (A11755)

Western blot analysis of extracts of various cell lines, using MMP13 Rabbit pAb (A11755) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.
ABclonal:Western blot - [KO Validated] MMP13 Rabbit pAb (A11755)}

Western blot - [KO Validated] MMP13 Rabbit pAb (A11755)

Western blot analysis of various lysates, using MMP13 antibody (A11755) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
ABclonal:Western blot - [KO Validated] MMP13 Rabbit pAb (A11755)}

Western blot - [KO Validated] MMP13 Rabbit pAb (A11755)

Western blot analysis of extracts from wild type(WT) and MMP13 knockdown (KD) 293T(KD) cells, using MMP13 antibody (A11755) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
ABclonal:Immunofluorescence - [KO Validated] MMP13 Rabbit pAb (A11755)}

Immunofluorescence - [KO Validated] MMP13 Rabbit pAb (A11755)

Immunofluorescence analysis of C6 cells using MMP13 Rabbit pAb (A11755) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - [KO Validated] MMP13 Rabbit pAb (A11755)}

Immunofluorescence - [KO Validated] MMP13 Rabbit pAb (A11755)

Immunofluorescence analysis of L929 cells using MMP13 Rabbit pAb (A11755) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - [KO Validated] MMP13 Rabbit pAb (A11755)}

Immunofluorescence - [KO Validated] MMP13 Rabbit pAb (A11755)

Immunofluorescence analysis of U2OS cells using MMP13 Rabbit pAb (A11755) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A11755 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on MMP13. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to MMP13. (Distance between topics and target gene indicate popularity.) MMP13

* Data provided by citexs.com, for reference only.

Publishing research using A11755? Please let us know so that we can cite the reference in this datasheet.

Antibodies (4)

ELISA Kits (1)

Proteins (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order